KEGG   Pseudomonas stutzeri A1501: PST_0947Help
Entry
PST_0947          CDS       T00511                                 

Gene name
ccpR
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
psa  Pseudomonas stutzeri A1501
Brite
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PST_0947 (ccpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1052080..1053072)
Genome map
AA seq 330 aa AA seqDB search
MVTGAASADDLRERANAIFKPIPDKVTEVRGQKVSEDQAMLGHKLWFDPRLSSSHVISCN
TCHNLSIGGSDNVPTSIGHGWQKGPRNSPTVLNAVFNAAQFWDGRAKDLQEQAKGPVQAS
VEMNSTPERVVATLKSIPEYAAEFKKAFPKDKDPVSFDNMAYALEAFEVSLTTPNSPFDR
FLKGEDKALDDKQKQGLALFMDAGCSACHNGVNLGGQGYFPFGVVKKPGAEVLPAGDKGR
FTVTNTASDEYVFRAAPLRNVALTPPYFHSGEVWELEQAVAIMGDSQLGRQLNQDEVSAI
TAFLRSVTGDQPQVAYPVLPASTADTPKPQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttggtcaccggcgccgcgagcgctgacgatcttcgcgaacgcgccaatgccatcttcaag
ccgattccggacaaggtcaccgaggtgcgtggccagaaggtcagcgaggatcaggccatg
ctcgggcacaagctgtggttcgacccgcgcctgtccagcagccatgtgatcagctgcaac
acctgtcacaacctgagcatcggcggcagcgacaacgtgccgacgtccatcggccatggg
tggcagaaaggcccgcgcaactcgcccaccgtgctgaatgccgtgttcaacgccgcccag
ttctgggatggccgcgccaaggatctccaggaacaggccaagggcccggtccaggcgagc
gtggaaatgaacagcacgcccgaacgcgtcgtcgccacgctcaagagcattccggagtac
gccgccgagttcaagaaggccttcccgaaagacaaggacccggtcagcttcgacaacatg
gcctatgcgctggaagccttcgaagtcagcctgaccacgccgaactcaccgttcgaccgc
ttcctcaagggcgaggacaaggccctggatgacaagcagaagcaaggcctcgcgctgttc
atggacgcgggctgttccgcctgccacaacggcgtgaaccttggcggccagggctacttc
cccttcggcgtcgtcaagaagccgggtgccgaagtgctgccggccggcgacaagggccgc
ttcacggtgaccaataccgccagcgacgaatacgtcttccgcgccgcgccgctgcgcaac
gtcgccctgacgccgccgtacttccacagcggcgaggtctgggaactggagcaggcggtg
gccatcatgggcgacagccagctgggccgtcagctcaatcaggacgaggtcagcgccatc
accgccttcctgcgcagcgtgaccggcgatcagcctcaggtagcctacccggttcttccg
gcgagcaccgccgacacgccgaaaccgcagtaa

DBGET integrated database retrieval system