KEGG   Pseudomonas stutzeri A1501: PST_0959Help
Entry
PST_0959          CDS       T00511                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00330  Arginine and proline metabolism
psa00332  Carbapenem biosynthesis
psa01100  Metabolic pathways
psa01130  Biosynthesis of antibiotics
psa01230  Biosynthesis of amino acids
Module
psa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PST_0959 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PST_0959 (proB)
Enzymes [BR:psa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PST_0959 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABP78656
UniProt: A4VI55
Position
1063516..1064634
Genome map
AA seq 372 aa AA seqDB search
MRDKVSGARRWVVKIGSALLTADGRGLDQAAMAVWVDQMVALRAAGVELVLVSSGAVAAG
MSRLGWASRPKAVHELQAAAAVGQMGLIRAWESSFARCDQQTAQILVTHDDLSDRKRYLN
ARSTLRTLIDLGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRHNPEANLISEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTVIVGG
RIEQVLSRLKAGERLGTLLAPECNRHAARKQWLAGHLQTRGTLTLDEGAVLALRQGNRSL
LPVGVRAVQGAFRRGEMVVCVGPQGAEVARGLVNYSAAEAQRILGRPSDEIEKLLGYVDE
PELIHRDNMILV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaaggtgagcggcgcgcggcgctgggtggtgaagattggcagtgcgctgctg
accgccgacggtcgagggctcgatcaggcggcgatggctgtctgggtcgaccagatggtg
gcgctgcgagcggcgggcgtcgagctggtgctggtctcgtccggtgcggtggctgccggc
atgagtcgtctcggctgggcttcgcgccccaaggcggtgcacgaacttcaggctgccgct
gcggtgggccagatggggttgattcgtgcctgggagtcgagctttgcgcgctgcgatcag
cagactgcgcagattctggtcacccatgacgatctgtccgatcgcaagcgctacctcaat
gcgcgcagcacgttgcgcacgctcatcgatctcggcgtggtgccggtcatcaacgagaac
gacacggtcgtcaccgacgagatccgcttcggtgacaacgataccctggccgcactggtt
gccaacctggtcgaggccgacctgctggtgatcctcaccgatcgcgatggcatgttcgat
gccgatccgcgccataaccccgaagccaatctgatcagcgaggcgcgtgccgacgacccg
gcgctggatgcggtcgcaggcggcaccggtggcgccctggggcgcggcggcatgcagacg
aagctccgggcggcgcgcctcgctgcgcgttccggtgcgcacacggtgatcgtcggtggg
cgcatcgagcaggtgctgtcgcgcctcaaggcgggcgagcggctgggtaccctgctggcg
cctgaatgcaatcggcatgcggcgcgcaagcaatggctggccgggcatctgcagacgcgt
ggcacgctgaccctggatgaaggggcagtgctggccttgcgtcagggcaaccgcagcctg
ctgccggtcggcgtgcgtgcggtgcagggcgcgttccgccgtggcgagatggtggtctgc
gtcggaccgcagggcgccgaggtggcgcgtgggctggtgaattacagtgcagccgaggcg
cagcgcattctcgggcggccatccgacgagatcgaaaagctgctgggctatgtcgatgag
cccgagttgatccatcgcgacaacatgattctggtctga

DBGET integrated database retrieval system