KEGG   Pseudomonas stutzeri A1501: PST_1046Help
Entry
PST_1046          CDS       T00511                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psa01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:psa00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1154321..1155628
Genome map
AA seq 435 aa AA seqDB search
MTAPSAIRRLNAADADFARHLDHLLSWESVSDDGVNERVLEIIKAVRERGDAAVVELTQR
FDALEVASMADLILPRARLEQALERITPAQREALEIAAERVRSYHERQKQDSWTYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVSEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPPVDKIVGPGNIYVATAKRHVFGKVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQSILVSPDAAFLDRVAESIARLLPTLER
ADIARTSIEGRGALIQVADMQQAIEVANRIAPEHLELSVAEPEQWLPQIRHAGAIFMGRY
TAEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIINCSAEGASTLGKVASVLARG
ESLTAHARSAEYRIK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccttccgccattcgccgactcaacgctgccgatgccgactttgcccgtcat
ctggaccatctgctgagctgggaaagtgtttctgatgacggtgtgaacgagcgggtcctc
gagatcatcaaggccgtgcgcgagcgtggtgatgcagcggttgtcgaactgacccagcgc
ttcgatgctctggaagtcgcctccatggcggacctgatccttccgcgcgcgcgcctggag
caggcgctcgagcggatcacgccagcgcagcgcgaggccctggagatcgccgccgagcgc
gtacgcagctatcacgagcggcagaaacaggactcctggacctataccgaggccgacggc
acggtgctcggtcagaaggtcaccccgctggatcgcgccggcctctacgtgccgggcggc
aaggcttcctacccgtcttctgtgctgatgaatgccatcccggccaaggtcgccggcgtg
tcggaagtggtcatggtggtgcccacaccgcgcggcgaggtcaacgagctggtgctggct
gctgcctgcatcgccggcgtagaccgcgtcttcaccattggcggggcgcaggccgtcgcg
gcattggcctatggcaccgagagcgtaccgccggtggacaagatcgtcggcccgggcaat
atctacgtcgccacggccaagcgccacgtgttcggcaaggtcggcatcgacatgatcgcc
gggccgtcggaaattctcgtggtctgcgatggccagaccgatccggactggatcgccatg
gacctgttctcccaggccgaacacgacgaggatgcgcagtcgatcctggtcagcccggac
gccgctttcctcgatcgcgtcgccgagagcattgcccgtctgctgccgaccctggagcgc
gccgacatcgctcgcacctccatcgagggccgcggcgcgctgatccaggtggccgacatg
cagcaggccatcgaggtggccaaccgcatcgcccctgagcacctggagctttcggtcgcc
gagccggaacaatggctgccgcagattcgtcatgccggtgcgatcttcatgggacgctac
accgccgaggcgctgggtgattactgcgcagggcccaaccacgtgctgccgacctccggt
accgcgcgcttttcctcgccgctgggcgtttacgacttccagaagcgctcgtcgatcatc
aattgctcggccgagggcgcttcgacgctgggcaaggtggcatcggttctggctcgtggt
gaatcgctgaccgctcacgcgcgcagcgccgagtatcggatcaagtaa

DBGET integrated database retrieval system