KEGG   Pseudomonas stutzeri A1501: PST_1129Help
Entry
PST_1129          CDS       T00511                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PST_1129
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PST_1129
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PST_1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1242823..1243305
Genome map
AA seq 160 aa AA seqDB search
MSAFHQLVLPGLGGEELPLAQFGDRITLVVNVASQCGLTPQYAGLERLQQQYAARGFSVL
GVPCNQFAAQEPGSDDEIRSFCTLNYGVSFPLSGKLEVNGPQRHPLYRLLAGEGADFPGD
ISWNFEKFLVGKDGRVLARFSPRTAPDDPALIQAIESALA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattccatcaattggtgttgccaggcctgggcggcgaggaattgccgctggcg
cagttcggcgatcggatcacgctggtggtcaatgttgcctcccagtgcggactgacgccg
cagtacgccggcctcgagcggttgcagcagcagtacgccgctcgaggcttcagcgtgctg
ggtgtgccgtgcaatcagttcgcggcgcaggagcccggcagcgacgatgagatccgctcg
ttctgcacgctgaattacggcgtcagcttccccctgagtggcaagctcgaagtcaatgga
ccgcagcgtcatccgctgtatcggctgctggcgggtgagggcgccgatttccccggggac
atcagctggaacttcgagaagtttctcgtcggcaaggacggtcgcgtcctggcgcgcttc
tcgccgcgcaccgcgccggacgatcctgccttgatccaggcgatcgaaagcgctctggcc
tga

DBGET integrated database retrieval system