KEGG   Pseudomonas stutzeri A1501: PST_1196Help
Entry
PST_1196          CDS       T00511                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psa  Pseudomonas stutzeri A1501
Brite
Enzymes [BR:psa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PST_1196 (dsbC)
Secretion system [BR:psa02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PST_1196 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304881..1305609
Genome map
AA seq 242 aa AA seqDB search
MGVIRMFAAATVGLVSTVAMAADPDQAIRQSLQKIQPDMPIEAVAESPMPGVYQVQLEGG
RQLYASADGQFVIQGYLYQFKDGQAVNLTEQAQSRSVAKQINAIPASEMVVFAPKAPKTH
ITVFTDTDCGYCQKLHSEVPQLNRLGVEVRYVAFPRQGMGSHGANTLTSVWCAKDRQDAM
NKAKAREELPAASCDTPIAKQYQLGQMIGVQGTPAIILANGQMIPGYQPAAQLAEVALAA
AK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgattcgtatgttcgctgccgccacagttggtctggtcagcaccgttgcaatg
gccgccgatccggatcaggcaattcgtcaatccctgcagaaaattcagcccgacatgccg
atcgaggcggtagccgagagcccgatgccgggggtgtatcaggttcagctggaaggcggg
cggcagctgtatgccagtgccgacggtcagtttgtcattcagggttatctctaccagttc
aaggatgggcaggcggtcaacctgaccgagcaggcgcagagccgatcggtggccaagcag
atcaacgccattccggcgagtgagatggtggtgttcgcacccaaggcgccgaaaacccat
atcaccgtgttcaccgataccgattgtggctattgccagaagctgcacagcgaagtgcct
cagctcaaccgtctcggtgtggaggtgcgctatgtggcgttcccgcgccaggggatgggc
agccacggtgccaataccctgaccagtgtgtggtgcgccaaggaccgtcaggatgccatg
aacaaggccaaggctcgtgaagaactgccggcagccagttgcgataccccgatcgccaag
caataccagttggggcagatgatcggtgtgcagggtacgccggccatcattctcgccaac
ggtcaaatgatccccggctatcagccagcggcgcagcttgcagaggtggcgctcgctgcg
gccaagtaa

DBGET integrated database retrieval system