KEGG   Pseudomonas stutzeri A1501: PST_1199Help
Entry
PST_1199          CDS       T00511                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PST_1199 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PST_1199 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PST_1199 (thrC)
Enzymes [BR:psa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PST_1199 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1307681..1309090
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTVEEIASWAGLPYHELAFRVMR
PFVAGSIPDADFKKILEETYGVFAHGAIAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLAKRGERVVIMGATSGDTGSAAIEGCRRCENVDIFILHPHQRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPINQLIVATNRNDILHRFMSGNHYDKDTL
HPSLSPSMDIMVSSNFERLLFDLHGRNGKAVADLLDGFRASGRLSVEEDRWTEARRLFDS
LAVDDEQTCATIARVFKETGEVLDPHTAIGVHAARECRRSLSIPMVTLGTAHPVKFPDAV
EKAGIGQALALPAHLADLFERSERCTVLPNELKAVQAFVGQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacatcagcacccgcggccaggcaccggccctgaatttcgaagatgtgctgctg
gccggtctggccagcgacggcggcctctacgtgccggagaacctgccgcgcttcaccgta
gaggaaatcgcttcctgggccggcctgccgtatcacgaactggcgttccgggtcatgcga
ccattcgttgccggcagcattccggatgccgacttcaagaaaatcctggaagagacctat
ggcgttttcgcccatggcgccattgccccgctgcgccagctgaacggcaacgagtgggta
ctcgagctgttccacggtccgaccttggccttcaaggatttcgccctgcagctgctcggc
cgtctgctcgactacgtgctggccaagcgtggcgagcgcgtggtgatcatgggagccacc
tccggtgataccggctcggcggccatcgaaggctgccgccgttgcgagaacgtcgatatc
ttcatcctgcacccgcaccagcgcgtgtcggaagtgcagcgccggcagatgaccactatc
ctcggcgacaacattcacaacatcgccatcgaaggcaacttcgatgactgccaggagatg
gtcaaggccagcttcgccgaccaggggttcctcaagggcacccgcctggtggcagtcaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgccgcactgcag
ctgggcggcccggcgcgttcggtcgccttctcggtcccgaccggcaatttcggtgacatc
ttcgccggctacctggcgcgcaacatggggctgccgatcaatcagctgatcgttgccaca
aaccgcaacgacatcctgcaccgtttcatgtccggcaatcactacgacaaggacacgctg
catccctcgctgtcgccgtccatggacatcatggtgtcgtccaacttcgaacgcctgctg
ttcgacctgcacggtcgcaacggcaaggccgtagccgatctgctggatggcttccgcgcc
agcggcaggctctcggtggaagaggatcgctggaccgaagcgcgtcgactcttcgattcg
ctggcggtggacgacgagcagacctgcgcgaccatcgcccgggtgttcaaggagaccggt
gaggtgctcgatccgcataccgccatcggcgtgcacgccgctcgtgaatgccgtcgtagc
ctgagcatcccgatggtcacgctgggcaccgcgcatccggtgaaattcccggatgcggtg
gagaaggccggtatcggtcaggcgctggcgctgccggcgcaccttgccgacctgttcgag
cgcagcgagcggtgcacggtgttgccaaacgagctcaaggcggtgcaggccttcgtcggc
cagcacggcaatcgcggcaagccgctctaa

DBGET integrated database retrieval system