KEGG   Pseudomonas stutzeri A1501: PST_1360Help
Entry
PST_1360          CDS       T00511                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:psa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:psa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1459253..1459801
Genome map
AA seq 182 aa AA seqDB search
MKLLTLIALSALALPVMPAAASECPAVLQHEMPKLRSKDSVDLCQTFQGKALVVVNTASH
CGFTPQFKGLEALYQRYKGDGLEVLGVPSDDFFQESDDEAETAEVCYVNYGVTFTMTQTQ
AVRGRDATPLFRELAEQAGQAPRWNFYKYVVDRQGRVVAHFSSKVNPDDPRLIAAVEKAL
AR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttctcacgctcattgccctgtctgcgctcgccttgccggtaatgccggcggcg
gccagcgaatgtccggccgtgctgcagcacgagatgccgaagctgcgctccaaggacagc
gtcgatctgtgccagaccttccagggcaaggcgctggttgtggtcaatacggccagccac
tgcggtttcaccccgcagttcaagggcctcgaggcgctctatcagcgctacaagggcgac
ggcttggaggtgctgggcgtgccatcggacgacttcttccaggagtcggacgatgaagcc
gagacagccgaggtgtgctacgtgaactacggcgtgaccttcaccatgacccagacccag
gcagtgcgcgggcgtgacgccacgccgctgttccgcgaactcgcggagcaggctggacag
gcgccgcgctggaacttctacaagtacgtggtcgatcggcaggggcgcgtcgtcgcgcat
ttttccagcaaggtaaatccggatgatcctcgcttgatcgcggcggtggaaaaggcgctg
gcgaggtag

DBGET integrated database retrieval system