KEGG   Pseudomonas stutzeri A1501: PST_1569Help
Entry
PST_1569          CDS       T00511                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
psa  Pseudomonas stutzeri A1501
Brite
Enzymes [BR:psa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PST_1569 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1684262..1684939
Genome map
AA seq 225 aa AA seqDB search
MRHRGQDSLLHGSGMTSQRTRDRLIQRLYEEGLSNAHVLEVIRRTPRHLFVDEALAHRAY
EDTALPIGHNQTISQPFMVARMSELLLADGPLDKVLEIGTGSGYQTAVLAQLVERVFSVE
RIQALQDRAKERLVELKLRNVVFRWGDGWEGWPALAPYNGIIVTAAAADVPQALLDQLAP
GGRLVIPVGAGEVQQLMLIIREENGFSRHLLDTVRFVPLLNGPVI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgagacatcgcggacaagacagcctgctccacggctcgggtatgacctcgcaacgcaca
cgtgaccgcttgattcagcgactctacgaagaaggcctgtccaacgcccatgtgctcgag
gtgatccgccgtacccctcgtcatctgttcgtcgacgaggcactggcgcatcgcgcctac
gaggacacggcgctgcccatcggccacaaccagaccatttcgcagccgttcatggttgcg
cgcatgagcgagctgctgctggccgacggcccgctggacaaggtgctagagatcgggacc
ggctcgggctatcagaccgccgtgctggcgcagctggtcgagcgggtgttctcggtcgag
cgcatccaggcgctgcaggatcgggccaaggagcgcctggtcgaactcaagctgcgcaat
gtggtctttcgctggggcgatggttgggagggctggcctgcactggcgccttacaacggc
atcatcgtcaccgcggcggcagccgatgtgccgcaggccttgctcgatcagctggcgccc
ggtgggcgcctggtgattccggtcggggccggcgaggtccagcaactcatgctgatcatt
cgagaggaaaacggcttttctcgccatcttctggataccgtacgtttcgtgccgctgctc
aatggacccgtgatttga

DBGET integrated database retrieval system