KEGG   Pseudomonas stutzeri A1501: PST_1603Help
Entry
PST_1603          CDS       T00511                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:psa00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1715425..1716933)
Genome map
AA seq 502 aa AA seqDB search
MSNQNKQFIVALDQGTTSSRAIVLDRNANVVTIAQREFAQIYPQPSWVEHDPMEIWATQS
GVFVEALAQAGITNEQVAAIGITNQRETAIVWDKITGRPIYNAIVWQSRQSTPICDQLKR
DGMEDHIRKTTGLVIDPYFSGTKIKWILDHVEGSRERARRGELLFGTVDCWLIWKMTQGK
AHVTDYTNASRTLLFDIHKLDWDPVMLEALDIPREMLPEVRSSSEVYGHAYIGSGQSTGI
PIAGIAGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGTKAVQSEHGLLTTIACGPRGE
VNYALEGAIFNGGSTVQWLRDELKVLNESLDSEYFATKVPDSNGIYLVPAFTGLGAPYWD
PRARGALFGLTRGVKVDHLIRAALESIAYQTRDVLDAMQQDAGERLRALRVDGGAVANNF
LMQFQADLLGTQVERPQMKETTALGAAYLAGLATGFWSDLDELRSKSSIERVFEPACGSE
QREALYRGWQKAVERTRNWAED
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccagaacaagcaattcatcgtcgccctcgaccagggcaccaccagttcccgc
gccatcgtgctggaccgcaacgccaacgtggtgaccatcgcccagcgcgagttcgcgcag
atctacccgcaaccgagctgggtcgagcatgaccccatggaaatctgggcgacccagagc
ggcgtgttcgtcgaagccctggcccaggccggcatcaccaacgagcaggtggccgccatc
ggcatcaccaaccagcgcgagaccgccatcgtctgggacaagataaccggccgtccgatc
tacaacgccatcgtctggcagagccgccagagcacgccgatctgcgaccagctcaagcgc
gacggcatggaagaccacatccgcaagaccaccggcctggtgatcgacccctacttctcc
ggtaccaagatcaagtggattctcgatcacgtcgaaggcagccgcgagcgcgctcgccgt
ggcgagctgctgttcggcaccgtcgactgctggctgatctggaagatgacccagggcaag
gcccacgtcaccgactacaccaacgcgtcgcgcacgctgctgttcgatatccacaagctg
gactgggacccggtgatgctcgaagcgctggacattccccgcgagatgctgccggaggtg
cgctcatcctcggaagtttacggccacgcctatatcggttccggccagagcaccggcatt
cccatcgcgggcattgccggcgatcagcaggccgcgctgttcggccagatgtgcgtcgaa
cccgggcaggccaagaacacctacggcaccggctgcttcctgctgatgaataccgggacc
aaggcagtgcagtccgaacatggtctgctgacgaccatcgcctgcgggccgcggggcgaa
gtgaattacgcgctggaaggcgccatcttcaatggcggctccaccgtgcagtggctgcgt
gacgaactgaaggtgctcaacgaatcgctggattcggagtacttcgccaccaaggtgccg
gacagcaacggcatctacctcgtgccggcgttcaccggccttggcgcgccctactgggac
ccgcgtgcccgcggcgcactgttcggcctgacccgcggggtcaaggtcgatcacctgatc
cgtgctgcgctggaatctatcgcctaccagacccgcgacgtgctcgacgccatgcagcag
gatgccggcgagcgcctgcgcgccctgcgtgtggatggcggcgccgtggccaacaacttc
ctcatgcagttccaggccgacctgctcggcacccaggtcgaacgcccgcagatgaaggaa
accaccgcccttggtgcggcctacctggccgggctggcgaccggtttctggagtgacctc
gacgaattgcgcagcaagagcagcatcgagcgcgtgttcgaaccggcgtgcggaagcgaa
cagcgcgaagcgctctatcgcggctggcagaaggcggtcgagcgcacccgcaactgggcc
gaggactga

DBGET integrated database retrieval system