KEGG   Pseudomonas stutzeri A1501: PST_1737Help
Entry
PST_1737          CDS       T00511                                 

Gene name
nagZ
Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00520  Amino sugar and nucleotide sugar metabolism
psa01100  Metabolic pathways
psa01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PST_1737 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PST_1737 (nagZ)
Enzymes [BR:psa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PST_1737 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ABP79415
UniProt: A4VKB4
Position
1870546..1871343
Genome map
AA seq 265 aa AA seqDB search
MQRLRQGFVRLPAMRELARCTDAPRLAEACGWVMASEVLAVGLDFSFAPVLDLDHQRSAV
VGARAFEGDPQVAVPLIDSFIRGMHAAGMAATGKHFPGHGWAEADSHVAIPVDERSLDEL
RRCDLIPFMALSGTLDAIMPAHVIYPQVDEQPAGFSRRWLQDILRNELGFKGVIFSDDLS
MAGAHVAGDAAQRIESALGAGCDMGLVCNDRGAAELALTALQRLKVTPSTALAGMRGRAG
CPADYKQNPRWLDAIGALKAADLID
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcggctgcgccagggtttcgtgcggcttccggcgatgcgcgaactggcgcgttgc
accgacgctcccaggctggccgaagcctgtggctgggtcatggccagcgaggtgcttgcg
gtgggcctggatttcagcttcgcgccggttctcgatctggatcatcagcgcagcgcggtg
gtaggtgcgcgcgccttcgagggtgacccgcaggtcgcggtgccgctgatcgactccttt
attcgcggcatgcatgccgccggcatggccgccactggcaagcacttccccgggcacggc
tgggctgaggccgattcgcatgtcgcgataccggtggatgagcgcagcctcgacgagctg
cgccgctgtgatctgattccctttatggcgctgagtggcacgctcgatgcgatcatgccg
gcgcatgtcatctatcctcaggtcgacgagcagcccgccggtttttcccggcgctggttg
caggacatcctgcgcaacgagctgggcttcaaaggcgtgatcttcagcgacgatctctcg
atggccggggcgcatgtcgcaggcgacgcggcgcagcggatcgaatccgctctgggcgct
ggttgcgacatggggctggtctgcaacgatcgtggggccgcagagctggcgctgactgcg
ctgcagcgcttgaaggtgacgccgtcgaccgcgctggcgggaatgcgtggccgggcgggt
tgcccggcggactacaagcagaaccctcgctggctggacgccatcggcgcgctgaaggct
gccgatctgattgactga

DBGET integrated database retrieval system