KEGG   Pseudomonas stutzeri A1501: PST_1743Help
Entry
PST_1743          CDS       T00511                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PST_1743
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PST_1743
Enzymes [BR:psa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PST_1743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1876859..1878067)
Genome map
AA seq 402 aa AA seqDB search
MSSDPRFTAMPDANGYFGPYGGQLVPPHLKQAMDDINLAYEEIRQREDFQQELAALFADY
VGRPSPIFHARRLSEQLGGAQIHLKREDLNHTGAHKINHCLGEALLARFMGKTKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMKILGCKLVAVTRGAATLKEAVD
SAFEEYLKDPQNYLYAIGSVVGPHPFPKMVRDFQSIIGQEARGQFLARHGRLPDQVVACV
GGGSNAMGIFTAFLEDAAVELVGIEPAGESLDKPGRHSATLSKGKPGELHGMACYVLEDA
EGNPSAVHSIASGLDYPGVGPQHSYLKDIGRVNYQTATDQECLDAFMTLSRVEGIIPALE
SAHAVAWAIRTAPTLGKDSHILVNLSGRGDKDADYVAKLLGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgatcctcgtttcactgccatgcccgacgccaacggctacttcggcccctac
ggtggccagctggtgccgccgcacctcaagcaggcgatggacgacatcaacctggcctac
gaagagatccgccagcgcgaggatttccagcaggaactggcggccctgttcgccgactac
gtgggccggccgagcccgatcttccatgcccggcgcctctccgagcagctcggtggcgcg
cagattcacctgaagcgcgaggacctgaatcacaccggggcacacaagatcaatcactgt
ctgggcgaggcactgcttgcccggttcatgggcaagaccaaggtgatcgccgagaccggc
gccggccaacacggtgtcgccctggccaccgcctgcgcgctggtgggcatcccctgcgaa
atccacatgggccaggtggacatcgagaaggaacatcccaacgttaccaagatgaagatc
ctcggctgcaagctggtggcggtcacccgaggcgcggcgacgctcaaggaagcggtggac
agcgccttcgaggaatacctgaaggatccgcagaactacctctacgccatcggctcggtg
gtaggcccgcatccgttcccgaagatggtccgcgatttccagtcgatcatcggtcaagag
gcgcgcggccagtttctcgccaggcatggtcgcctgccggaccaggtggtcgcctgcgtc
ggcggcggttccaatgccatgggcatcttcacagccttcctggaagacgccgcggtcgag
ctggtgggcatcgagccggccggcgaaagcctggacaagcccggccgccattcggccacc
ctgtccaagggcaaacccggtgaactgcacggcatggcctgctacgtgctggaagatgcc
gagggcaacccgtccgcagtgcactccatcgcctccggcctggactatcccggcgtcggc
cctcagcacagctacctcaaggacatcggccgggtgaactaccagaccgcgaccgaccag
gagtgtctggatgccttcatgaccctgtcgcgcgtcgaaggcatcatccccgccctggaa
agtgcccacgcggtggcctgggcgattcgtaccgcgccgacgctgggcaaggacagccac
attctggtcaatctgtccggccgcggcgacaaggatgccgactacgtcgccaagctgctc
ggcctgtaa

DBGET integrated database retrieval system