KEGG   Pseudomonas stutzeri A1501: PST_1822Help
Entry
PST_1822          CDS       T00511                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1967106..1967705
Genome map
AA seq 199 aa AA seqDB search
MSFSPLIRQLIDALRILPGVGQKTAQRMALQLLERDRSGGLRLAQALTRAMEGVGYCRQC
RTLTEDELCPQCADPRRDDSLLCVVQSPVDVFAVEQTGFRGRYFVLKGHLSPLDGLGPEA
IGIPELLGRVADGAFSEVILATNPTVEGEATAHYIAQMLIPKGLTISRIAHGVPLGGELD
LVDGGTLAHALAGRKPISL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagcccgctgattcggcaactcatcgatgccctgcgcattcttcctggcgta
ggacagaagaccgcgcaacgcatggcgctgcagctgctcgagcgtgaccgcagcggtggc
ctgcgcctggcgcaggcgttgacccgggcgatggaaggtgtcggctactgcaggcagtgc
cgtacgctgaccgaagacgaactctgcccgcagtgcgctgatccgcggcgggatgattcc
ctgctatgcgtggtgcagagcccggtcgacgtgtttgcggtcgagcagaccggctttcgt
gggcgttacttcgtgctcaaggggcatctgtctccgctcgatggcctggggccggaggcc
atcggcattccggagctgctggggcgggtggcggatggcgcattcagcgaagtcatcctg
gcaacaaaccccactgtcgaaggggaagccaccgcgcactacatcgcacagatgctcatt
cccaaaggcctgaccatcagccgaattgcccatggtgttccactgggcggcgagctggac
ctggtcgatggcggcacactggctcacgccctcgcagggcgcaagccgatcagcctataa

DBGET integrated database retrieval system