KEGG   Pseudomonas stutzeri A1501: PST_1872Help
Entry
PST_1872          CDS       T00511                                 

Gene name
sdhD
Definition
succinate dehydrogenase (D subunit)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PST_1872 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PST_1872 (sdhD)
   00650 Butanoate metabolism
    PST_1872 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PST_1872 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2019937..2020305
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYFLFLLGYLIANPGLEYTQWHALFSANWMRIF
SLLALVALSVHAWVGMWTISTDYLTNMAIGKWATGVRFLFQAVCGIAMFTFFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcaccaacttttcgcgctcgggtctgtacgactggatggcgcagcgc
gtttctgcagtggttcttgcggcttattttctgttcctgcttgggtacctgatcgcgaac
ccgggactggagtacacccagtggcacgcgctgttctcggccaactggatgcgcatcttc
agcctgctggctctggtcgccctgagtgtgcacgcgtgggtaggcatgtggacgatctcc
accgactacctgaccaatatggcgatcggtaagtgggctaccggcgttcgtttcctgttc
caggcggtgtgtggcattgccatgttcaccttcttcgtctggggcgtgcagattctttgg
ggtatctga

DBGET integrated database retrieval system