KEGG   Pseudomonas stutzeri A1501: PST_1878Help
Entry
PST_1878          CDS       T00511                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00020  Citrate cycle (TCA cycle)
psa00640  Propanoate metabolism
psa00660  C5-Branched dibasic acid metabolism
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01130  Biosynthesis of antibiotics
psa01200  Carbon metabolism
Module
psa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PST_1878 (sucC)
   00640 Propanoate metabolism
    PST_1878 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PST_1878 (sucC)
Enzymes [BR:psa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PST_1878 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ABP79552
UniProt: A4VKQ1
Position
2028944..2030110
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDSPKEAAEACDKIGGTQWVVKAQVHAGGRGKAGGV
KLVRSKDEARAFAQQWLDKRLVTYQTDANGQPVSKILVEACTDIDKELYLGAVVDRASRR
IVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPFQARELAFQLGLKGDQVKQFVHI
FVGLAQLFQDYDLALLEVNPLVIKTDGNLHCLDAKINIDSNAIYRQPKLRDMADPSQDDP
REAHAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGAPANFLDVGGGATEERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVREVGVKVPVVVRLEGNNADLGAKM
LSESGLNIIGANSLTDAAIQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtaccaaggtaaacaactgttcgctgaatacggtctgcccgtgtcc
aaaggctatgcggtagatagcccgaaggaagcagcggaagcctgcgacaagatcggcggc
acacaatgggtggtcaaggcccaagtgcatgccggtggacgtggcaaggcgggtggcgta
aagctggttcgcagcaaggatgaggcccgggcgttcgcccagcagtggctcgacaagcgt
ctggtgacctaccagaccgatgccaatggtcagccggtcagcaagattctggtcgaggcg
tgcaccgatatcgacaaggagctctacctgggcgccgtggtcgatcgcgccagtcgccgg
atcgtcttcatggcgtcgaccgaaggtggcgtggacatcgaaaaagtcgctcacgacacg
cccgagaagatcctcaaggccaccatcgatccgctggtaggcgcgcaacccttccaggcg
cgcgaactggcgttccagttgggcctcaagggtgaccaggtcaagcagttcgtacacatc
ttcgtcggcctcgcccagctgttccaggactatgacctggccctgctggaagtgaacccg
ctggtgatcaagaccgacggcaatctgcactgcctggacgccaagatcaacatcgacagc
aacgccatctatcgccagccgaagctgcgcgacatggccgacccgtcacaggacgatccg
cgcgaggcgcatgctgccaagtgggagctcaattacgtggcgctcgacggcaacatcggt
tgcatggtcaacggtgccggtctggccatgggcaccatggacatcgtcaacctgcacggc
ggcgcgccggcgaacttcctcgacgtgggcggtggcgccaccgaggagcgcgtgaccgaa
gcgttcaagatcattctctccgacagcaatgtcgctgcggttctggtgaacatcttcggt
ggcatcgtgcgttgcgacatgatcgccgagggcatcatcggtgccgtgcgtgaagtgggg
gtcaaggtgccggtggtggtgcggctggaaggcaacaacgccgacctgggcgccaagatg
ctgagtgagagcggtctgaacatcatcggtgcgaacagcctgaccgatgcggccattcag
gttgtcaaagccgcggagggcaagtaa

DBGET integrated database retrieval system