KEGG   Pseudomonas stutzeri A1501: PST_1878Help
Entry
PST_1878          CDS       T00511                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PST_1878 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PST_1878 (sucC)
   00640 Propanoate metabolism
    PST_1878 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PST_1878 (sucC)
Enzymes [BR:psa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PST_1878 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2028944..2030110
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDSPKEAAEACDKIGGTQWVVKAQVHAGGRGKAGGV
KLVRSKDEARAFAQQWLDKRLVTYQTDANGQPVSKILVEACTDIDKELYLGAVVDRASRR
IVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPFQARELAFQLGLKGDQVKQFVHI
FVGLAQLFQDYDLALLEVNPLVIKTDGNLHCLDAKINIDSNAIYRQPKLRDMADPSQDDP
REAHAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGAPANFLDVGGGATEERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVREVGVKVPVVVRLEGNNADLGAKM
LSESGLNIIGANSLTDAAIQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtaccaaggtaaacaactgttcgctgaatacggtctgcccgtgtcc
aaaggctatgcggtagatagcccgaaggaagcagcggaagcctgcgacaagatcggcggc
acacaatgggtggtcaaggcccaagtgcatgccggtggacgtggcaaggcgggtggcgta
aagctggttcgcagcaaggatgaggcccgggcgttcgcccagcagtggctcgacaagcgt
ctggtgacctaccagaccgatgccaatggtcagccggtcagcaagattctggtcgaggcg
tgcaccgatatcgacaaggagctctacctgggcgccgtggtcgatcgcgccagtcgccgg
atcgtcttcatggcgtcgaccgaaggtggcgtggacatcgaaaaagtcgctcacgacacg
cccgagaagatcctcaaggccaccatcgatccgctggtaggcgcgcaacccttccaggcg
cgcgaactggcgttccagttgggcctcaagggtgaccaggtcaagcagttcgtacacatc
ttcgtcggcctcgcccagctgttccaggactatgacctggccctgctggaagtgaacccg
ctggtgatcaagaccgacggcaatctgcactgcctggacgccaagatcaacatcgacagc
aacgccatctatcgccagccgaagctgcgcgacatggccgacccgtcacaggacgatccg
cgcgaggcgcatgctgccaagtgggagctcaattacgtggcgctcgacggcaacatcggt
tgcatggtcaacggtgccggtctggccatgggcaccatggacatcgtcaacctgcacggc
ggcgcgccggcgaacttcctcgacgtgggcggtggcgccaccgaggagcgcgtgaccgaa
gcgttcaagatcattctctccgacagcaatgtcgctgcggttctggtgaacatcttcggt
ggcatcgtgcgttgcgacatgatcgccgagggcatcatcggtgccgtgcgtgaagtgggg
gtcaaggtgccggtggtggtgcggctggaaggcaacaacgccgacctgggcgccaagatg
ctgagtgagagcggtctgaacatcatcggtgcgaacagcctgaccgatgcggccattcag
gttgtcaaagccgcggagggcaagtaa

DBGET integrated database retrieval system