KEGG   Pseudomonas stutzeri A1501: PST_1916Help
Entry
PST_1916          CDS       T00511                                 

Gene name
fadAx
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PST_1916 (fadAx)
   00630 Glyoxylate and dicarboxylate metabolism
    PST_1916 (fadAx)
   00640 Propanoate metabolism
    PST_1916 (fadAx)
   00650 Butanoate metabolism
    PST_1916 (fadAx)
  Lipid metabolism
   00071 Fatty acid degradation
    PST_1916 (fadAx)
   00072 Synthesis and degradation of ketone bodies
    PST_1916 (fadAx)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PST_1916 (fadAx)
   00310 Lysine degradation
    PST_1916 (fadAx)
   00380 Tryptophan metabolism
    PST_1916 (fadAx)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PST_1916 (fadAx)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PST_1916 (fadAx)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PST_1916 (fadAx)
Enzymes [BR:psa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PST_1916 (fadAx)
Exosome [BR:psa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PST_1916 (fadAx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2066804..2067913
Genome map
AA seq 369 aa AA seqDB search
MTAWQLGAAAIRAAVERSGLPAESVQDVLMGCVLPAGQGQAPARQAALSAGLTRATTCTT
VNKMCGSGMQTVIMAHDQLLAGSADIVVAGGMESMSNAPYLLDRARGGYRMGHGRVLDHM
FLDGLEDSFDKGRLMGTFAEECADAFGFSREEQDGYALESLRRAQSAIAEGRFAEEIVTL
EVTQGKQQRQIRDDEQPPKAMPEKIPSLKPAFREGGTVTAANSSSISDGAAALLLMRRSE
AERWGLQPQAAIHGHAAYADAPNLFTTAPIGAIRKLMERTGWSTEDVDLFEINEAFAVVA
MASMRELGLDPAKVNVNGGACALGHPIGASGARILVTLLSALRARGLRRGVAAICIGGGE
ATAMAVELL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctggcagctcggtgctgccgccatccgcgcggcggtggaacgcagcggcctg
ccggccgagagcgtgcaggacgtgctgatgggctgcgtgctgcctgccggccagggccag
gcgccggctcgccaggcggctttgagcgccgggctgacccgcgccactacctgcaccacc
gtgaacaagatgtgcggctcgggcatgcagacggtgatcatggcccacgatcagctgctc
gccggcagcgccgatatcgttgtcgctggcggcatggaaagcatgagcaacgcaccgtat
ctgctcgaccgcgcccgcggcggctatcgcatgggccacggccgggtactcgaccacatg
ttcctcgatggcctggaggattcgttcgacaaaggccggctgatgggcactttcgccgag
gaatgcgccgacgccttcggcttcagccgcgaggagcaggatggctacgcgctggaatcg
ctgcgccgcgcccagtcggccatcgccgaggggcgtttcgccgaggagatcgtcacgctg
gaggtcacccagggcaaacagcagcggcagattcgtgacgacgagcagccgcccaaggcg
atgccggagaagattcccagcctcaaaccggccttccgagagggcggcacggtgaccgcg
gccaattccagttcgatctccgacggcgccgcggcgctgctgctgatgcgccgctccgag
gccgagcgctggggcctgcagccgcaggcggcgatccacggccacgcggcctacgctgat
gcgccgaatctgtttaccacggcgccgatcggggcgatccgcaagctgatggaacgcacc
ggctggtccaccgaagatgtggatctgttcgagatcaatgaagccttcgccgtggtcgcc
atggctagcatgcgcgagctgggcctggaccccgccaaggtaaacgtcaacggtggcgcc
tgtgcgctcgggcatcccatcggtgcttcgggtgcgcgaatcctggtgacgctgctttcg
gctttgcgcgcccgtggcctgcgccgcggcgtggcggcgatctgcatcggcggcggcgaa
gccacggccatggccgtcgaactgctctga

DBGET integrated database retrieval system