KEGG   Pseudomonas stutzeri A1501: PST_1925Help
Entry
PST_1925          CDS       T00511                                 

Gene name
fadB1x
Definition
(GenBank) enoyl-CoA hydratase/isomerase FadB1x
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00071  Fatty acid degradation
psa00280  Valine, leucine and isoleucine degradation
psa00281  Geraniol degradation
psa00310  Lysine degradation
psa00360  Phenylalanine metabolism
psa00362  Benzoate degradation
psa00380  Tryptophan metabolism
psa00410  beta-Alanine metabolism
psa00627  Aminobenzoate degradation
psa00640  Propanoate metabolism
psa00650  Butanoate metabolism
psa00903  Limonene and pinene degradation
psa00930  Caprolactam degradation
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01130  Biosynthesis of antibiotics
psa01212  Fatty acid metabolism
Module
psa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PST_1925 (fadB1x)
   00650 Butanoate metabolism
    PST_1925 (fadB1x)
  Lipid metabolism
   00071 Fatty acid degradation
    PST_1925 (fadB1x)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PST_1925 (fadB1x)
   00310 Lysine degradation
    PST_1925 (fadB1x)
   00360 Phenylalanine metabolism
    PST_1925 (fadB1x)
   00380 Tryptophan metabolism
    PST_1925 (fadB1x)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PST_1925 (fadB1x)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PST_1925 (fadB1x)
   00281 Geraniol degradation
    PST_1925 (fadB1x)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PST_1925 (fadB1x)
   00627 Aminobenzoate degradation
    PST_1925 (fadB1x)
   00930 Caprolactam degradation
    PST_1925 (fadB1x)
Enzymes [BR:psa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PST_1925 (fadB1x)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABP79599
UniProt: A4VKU8
Position
complement(2077859..2078632)
Genome map
AA seq 257 aa AA seqDB search
MTFETLLVDIQERVALITLNRPQALNALNAQLISELNQALGQLEADPRIGCIVLTGSAKA
FAAGADIKEMAELSYPQVYLDDLFAEADRIATRRKPLIAAVAGYALGGGCELALLCDMIF
AADNARFGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVARVF
PAESLLEETLKAARVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHAVFATADQK
EGMAAFSEKRKPEFTNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgaaaccctgctcgtcgacatccaggagcgcgttgcgctgatcaccctcaac
cggccgcaggcgctcaatgcgctcaatgcgcagctgatcagcgagctgaaccaggccctg
ggccagctcgaggccgatccgcggatcggctgcatcgtgctcaccggctcggccaaggcg
ttcgccgccggcgccgacatcaaggaaatggccgagctatcctacccgcaggtctatctc
gatgacctctttgccgaagctgaccgcatcgccacgcgccgcaagccgctgattgccgcc
gttgccggttacgcactgggtggtggctgcgaactcgccttgctctgcgacatgatcttc
gccgccgacaatgcgcgcttcggccagccggaagtcaacctaggcgtgctgccgggcatt
ggcggcacccagcgcctgacccgcgcagtgggcaaggccaaggcgatggacatgtgcctg
accggccgccagatggacgccgccgaagccgagcgcgccggcctggtcgcccgtgtattc
ccagccgaaagcctgctggaggaaaccctcaaggctgctcgggtgatcgccgagaaatcc
ctgccggccaccatgatgatcaaggaaagcgtcaaccgcgccttcgagaccacgctggca
gaaggcatccgcttcgagcgtcgagtgttccatgcggtgttcgcgaccgccgaccagaag
gaaggcatggccgcgttcagcgagaagcgcaagcctgagttcaccaatcgctga

DBGET integrated database retrieval system