KEGG   Pseudomonas stutzeri A1501: PST_1975Help
Entry
PST_1975          CDS       T00511                                 

Gene name
folE-1
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00790  Folate biosynthesis
psa01100  Metabolic pathways
Module
psa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PST_1975 (folE-1)
Enzymes [BR:psa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PST_1975 (folE-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI MAPKK1_Int
Motif
Other DBs
NCBI-ProteinID: ABP79649
UniProt: A4VKZ8
Position
complement(2144240..2144884)
Genome map
AA seq 214 aa AA seqDB search
MYITCTSYNFFAAGLGHRTAHLLHERVSTMNDLPGHYRDILTGLGEDPEREGLRDTPTRA
AKAMQYLCGGYQRSLEEIVNGALFASDNDEMVIVKDIELYSLCEHHLLPFIGKAHVAYIP
TGRVLGLSKVARIVDMYARRLQIQENLTRQIAEAIQEVTGAAGVAVVIEAKHMCMMMRGV
EKQNSVMNTSVMLGAFRNSCNTRMEFLQLIGRGQ
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ttgtacataacatgtacatcgtataatttttttgctgcgggactggggcacaggaccgct
cacctccttcatgaaagggtctccaccatgaacgatctgcccggtcactatcgcgacata
ctcaccggcctcggcgaagaccccgagcgcgaggggctgcgggatacgccaacgcgcgcc
gccaaggccatgcagtacctgtgcggcggttaccagcgcagcctggaggaaatcgtcaac
ggcgccctgttcgcctccgacaacgatgaaatggtgatcgtcaaggacatcgagctgtac
tcgctgtgcgaacaccacctgctgcccttcatcggcaaggcgcatgtcgcctacatcccc
accgggcgtgtgctgggtctgtccaaggtggcgcgcatcgtcgacatgtatgcgcggcgc
ctgcagatccaggaaaacctcacccgtcagatcgccgaagcgatccaggaagtgaccggc
gccgccggagtcgcagtggtcatcgaggccaagcacatgtgcatgatgatgcgcggcgtg
gagaagcagaactcggtgatgaacacgtcggtgatgctcggcgccttccgcaactcctgc
aacacgcgcatggagtttctccagctgatcggcaggggccagtga

DBGET integrated database retrieval system