KEGG   Pseudomonas stutzeri A1501: PST_2139Help
Entry
PST_2139          CDS       T00511                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2318851..2320926
Genome map
AA seq 691 aa AA seqDB search
MSDEALIRLADAAGLSIDWVDADNRQQRVEPQVLREVLGCLGLEADTDQQIEASLKVIAH
QNNHGGVPPLLTCDQNAVLELAAYFPPSSRYELVAEQGDVLHGTLDDQARLHVPDTPGYH
RLRIDETELTVAVAPPSCPTVAQLAGPNAWGLTAQLYSLRRPGDGGLGDTQALEALLRNA
AAHGADALGISPVHAMFAAHINQYSPYSPSSRLFYNVLHAAPGSILGEWPVRQAIEACGL
GEELERLERLDLIDWPAVAQSRQRLLRQLFDDFSQGENPQQADFDSFRANGGEALENHCR
FEALHHHLRDAEGHPQHWRNWPQDYRDPASPAVERFAREHADEVSYQAFGQWLMARGLER
AQVAARSAGMRIGLVSDLAVGADGGGSQAWSRQGELLASLSVGAPPDVMNRDGQNWGISA
FSPWGLRQHGFRAYIEMLRANLAHAGGMRIDHVLGLKRLWVVPAGADPKRGVYLNFPFDD
MLRLLCLEAWRHQAVILGEDLGTIPHGFRDVLAAKGILGMRVLLFEQHDGHFQRADQYSD
QALATSTTHDIPTLRGWWNGHDIDWRIKVGQVQEADRDQQWRSREHERAGLNRALCEDGG
KDPHHLLSAEQAVDAAACFLGHTRAPLVLFPVEDALGLEEQTNMPGIVETHPNWRRRYPG
DSATLLDGEASRRRLECLAQARRNHRGAAHR
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgaagccctgatccgcctggctgacgctgccgggttgtccatcgactgggtg
gacgccgacaaccgtcagcagcgggtggagccgcaagtactgcgtgaagtgctcggttgc
ctcggactcgaggcagataccgaccagcagatcgaagccagcctgaaagtcatcgcgcat
cagaacaaccacggcggcgtaccaccgctgctgacctgcgaccagaacgccgtgctggag
ctggcggcctacttcccgccgtccagccgttacgaactggtggccgaacagggcgacgtg
ctgcacggcacgctggacgaccaggcacggctgcatgtgccggacaccccgggctatcac
cgcctgaggatcgacgaaaccgagctgaccgtggcggtcgcgccgccctcgtgccccacg
gttgcgcaactcgccggcccgaacgcctgggggctgacggcccagctgtacagcctgcgc
cgaccgggcgacggcgggctgggcgacacccaggcgctggaagccctgctgcgcaatgcc
gctgcccatggagccgacgcgctaggcatcagcccggtgcatgccatgttcgctgcgcat
atcaatcagtacagtccctactcgccctccagccgactgttctacaacgtgctgcacgcg
gcgccgggctccattctcggcgaatggccggtgcgtcaggccatcgaggcgtgcggactc
ggcgaggagctggagcgcctcgagcgactggacctgatcgactggcctgccgtggcgcaa
tcgcgtcagcgcctgctgcgccagctgttcgacgacttcagccagggcgagaacccgcaa
caggccgatttcgacagttttcgcgccaatggcggcgaagcgctggagaaccattgccgt
ttcgaggcgctgcaccaccatctgcgtgacgccgaaggccatccgcagcattggcgcaac
tggccgcaggactaccgcgacccggccagcccggcagtggaacgcttcgcccgcgaacat
gccgacgaggtcagctatcaggccttcggccagtggctgatggcgcgcgggctcgagcgc
gcacaggttgccgcacgcagcgcaggcatgcgcatcggtctggtctccgaccttgccgtc
ggcgccgacgggggtggcagccaggcctggagccgccagggcgaactgctcgcttcgctg
agcgtcggcgcaccgccggatgtgatgaaccgcgacggacagaactggggcatctccgcg
ttctcaccctggggcctgcgtcagcatggcttccgggcctatatcgaaatgctgcgcgcc
aatctcgcccacgccggcggcatgcgcatcgaccacgtgctgggcctcaagcgcctgtgg
gtggtgccggccggcgccgaccccaagcgcggcgtgtacctcaacttccccttcgacgac
atgctgcgcctgctctgcctggaggcctggcggcatcaggcggtgatcctcggcgaggat
ctcggcaccattccccacgggtttcgtgacgtgctcgccgccaagggcatcctcggcatg
cgggtactgctgttcgaacagcacgacggccatttccagcgtgccgaccagtattccgac
caggccctggcgaccagtaccacccacgacatcccgaccctgaggggctggtggaacggc
catgacatcgactggcgcatcaaggtcggtcaggtgcaggaagccgatcgcgatcagcaa
tggcgttcccgcgaacatgagcgcgccgggctcaaccgtgcgctctgcgaggatggcgga
aaagatcctcatcatctgctgagcgccgaacaagccgtcgatgccgcggcctgttttctc
ggccacacccgcgcgccgctggtgctgtttccggtcgaggacgccctcggcctggaggaa
cagaccaacatgccgggcatcgtcgaaacccaccccaactggcgtcgccgctatcccggc
gacagtgcaacgctgctcgacggcgaagccagccgccggcgcctggaatgcctggcgcag
gcacgccgcaaccatcgtggagctgcgcatcgatga

DBGET integrated database retrieval system