KEGG   Pseudomonas stutzeri A1501: PST_2239Help
Entry
PST_2239          CDS       T00511                                 

Definition
(GenBank) probable oxidoreductase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00010  Glycolysis / Gluconeogenesis
psa00071  Fatty acid degradation
psa00350  Tyrosine metabolism
psa00625  Chloroalkane and chloroalkene degradation
psa00626  Naphthalene degradation
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01130  Biosynthesis of antibiotics
psa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PST_2239
  Lipid metabolism
   00071 Fatty acid degradation
    PST_2239
  Amino acid metabolism
   00350 Tyrosine metabolism
    PST_2239
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PST_2239
   00626 Naphthalene degradation
    PST_2239
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PST_2239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Epimerase adh_short NAD_binding_10 ADH_N_2 NmrA GDP_Man_Dehyd RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ABP79898
UniProt: A4VLP7
Position
complement(2441945..2442937)
Genome map
AA seq 330 aa AA seqDB search
MSSFKALQVSETEGGRFESKVVERTTEELPAGEVLIRVRYSSLNFKDALSASGNRGVTRA
YPHTPGIDAAGVVASSSVAEFAEGDEVIVTGYDLGMNTAGGFGQYIRVPAAWIIKRPQGL
SLRDAMILGTAGLTAALCVDKLEQAGLEPGDAPVLVTGATGGVGSIAVALLASLGYKVAA
VTGKADQVDFLTRLGATQIVERAALQAGVDKALLKEQWGGAVDTVGGDILFNVVKSLQRG
ASAACCGLTAGTHFQASVLPFILRGVNLLGVDSVEIPLVVKASMWDKLSLQWKLANLDEL
AHEIGLEQLPEAIERILAGGQVGRVLVRLD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcttcaaggcactacaagtcagcgagaccgaaggtggccgtttcgagtcgaag
gtcgtcgagcgaaccaccgaagagctgcccgccggtgaggtgctcatccgggtgcgttat
tcctcgctgaatttcaaggatgcgctgtcggccagtggcaatcgtggcgtgacccgggcc
tatccgcatactccggggatcgatgccgccggtgtcgtggcctcgtccagcgtggccgag
ttcgccgaaggcgatgaagtgatcgtcaccggctatgacctgggcatgaataccgccggc
ggcttcggtcagtacatccgggttccggccgcctggatcatcaagcgtccgcaggggctg
tcactacgtgacgcgatgatactcggcacagccggcctgactgccgcactctgtgtcgac
aagctggaacaggctggtctcgagccgggagacgcgccggtgctggtgaccggtgcgacc
ggcggtgtcggcagtattgcagtggcgttgctggccagcctcggctacaaggtcgcggcc
gtgaccggcaaggccgaccaggtcgatttcctgacccgcctgggggccacgcagatcgtc
gaacgtgctgcattgcaggccggcgtggacaaggccttgctgaaggagcagtggggcggg
gcggtggataccgtgggcggggacattctgttcaacgtggtcaagtcgctgcagcgcggc
gccagtgcggcctgctgcggtctcactgccggcacgcatttccaggccagtgtactgccg
ttcattcttcgcggcgtgaacctgctgggcgtggactcggtggagattccgctggtggtc
aaggcatccatgtgggacaagctgtcgttgcaatggaagctggccaacctcgatgagctg
gcccatgagatcggtttggagcaactgccggaggccatcgagcgcatcctggcgggcggt
caggtcgggcgcgtgctggtgcgtctggattga

DBGET integrated database retrieval system