KEGG   Pseudomonas stutzeri A1501: PST_2239Help
Entry
PST_2239          CDS       T00511                                 

Definition
oxidoreductase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PST_2239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PST_2239
  Lipid metabolism
   00071 Fatty acid degradation
    PST_2239
  Amino acid metabolism
   00350 Tyrosine metabolism
    PST_2239
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PST_2239
   00626 Naphthalene degradation
    PST_2239
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PST_2239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2441945..2442937)
Genome map
AA seq 330 aa AA seqDB search
MSSFKALQVSETEGGRFESKVVERTTEELPAGEVLIRVRYSSLNFKDALSASGNRGVTRA
YPHTPGIDAAGVVASSSVAEFAEGDEVIVTGYDLGMNTAGGFGQYIRVPAAWIIKRPQGL
SLRDAMILGTAGLTAALCVDKLEQAGLEPGDAPVLVTGATGGVGSIAVALLASLGYKVAA
VTGKADQVDFLTRLGATQIVERAALQAGVDKALLKEQWGGAVDTVGGDILFNVVKSLQRG
ASAACCGLTAGTHFQASVLPFILRGVNLLGVDSVEIPLVVKASMWDKLSLQWKLANLDEL
AHEIGLEQLPEAIERILAGGQVGRVLVRLD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcttcaaggcactacaagtcagcgagaccgaaggtggccgtttcgagtcgaag
gtcgtcgagcgaaccaccgaagagctgcccgccggtgaggtgctcatccgggtgcgttat
tcctcgctgaatttcaaggatgcgctgtcggccagtggcaatcgtggcgtgacccgggcc
tatccgcatactccggggatcgatgccgccggtgtcgtggcctcgtccagcgtggccgag
ttcgccgaaggcgatgaagtgatcgtcaccggctatgacctgggcatgaataccgccggc
ggcttcggtcagtacatccgggttccggccgcctggatcatcaagcgtccgcaggggctg
tcactacgtgacgcgatgatactcggcacagccggcctgactgccgcactctgtgtcgac
aagctggaacaggctggtctcgagccgggagacgcgccggtgctggtgaccggtgcgacc
ggcggtgtcggcagtattgcagtggcgttgctggccagcctcggctacaaggtcgcggcc
gtgaccggcaaggccgaccaggtcgatttcctgacccgcctgggggccacgcagatcgtc
gaacgtgctgcattgcaggccggcgtggacaaggccttgctgaaggagcagtggggcggg
gcggtggataccgtgggcggggacattctgttcaacgtggtcaagtcgctgcagcgcggc
gccagtgcggcctgctgcggtctcactgccggcacgcatttccaggccagtgtactgccg
ttcattcttcgcggcgtgaacctgctgggcgtggactcggtggagattccgctggtggtc
aaggcatccatgtgggacaagctgtcgttgcaatggaagctggccaacctcgatgagctg
gcccatgagatcggtttggagcaactgccggaggccatcgagcgcatcctggcgggcggt
caggtcgggcgcgtgctggtgcgtctggattga

DBGET integrated database retrieval system