KEGG   Pseudomonas stutzeri A1501: PST_2311Help
Entry
PST_2311          CDS       T00511                                 

Definition
(GenBank) probable isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00630  Glyoxylate and dicarboxylate metabolism
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PST_2311
Enzymes [BR:psa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PST_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: ABP79970
UniProt: A4VLW9
Position
2522256..2523899
Genome map
AA seq 547 aa AA seqDB search
MGKSRCSTTLIFEGLNMSAYQDDIKAVAALKEQYGSSWAAINPESVARMRAQNRFKTGLE
IAQYTADIMRKDMAEYDADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWM
VAALRSEFGPLPDQSMHEKTAVSDLIEELYTFLRQADSRELDLLFTALDAAREAGDNAKA
AEIQNQIDNYETHIVPIIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGH
QDGKVTVPHADFLAKIAAVRYAFLELGIDNGVIVARTDSLGAGLTKQIAVTKEPGDLGDL
YNSFLDCEEISEAELGNGDVVIKREGKLLRPKRLPSNLFQFRAGTGEDRCVLDCITSLQN
GADLLWIETEKPHVGQIKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGK
DVSAYDRAKLMSVEYDETELAQVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDN
LAKGYFADQGMLAYVKGVQREELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKD
NTMNQFH
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaagtcggtgctcaaccacacttatttttgaaggattgaacatgtccgcatat
caagacgacatcaaggcagttgccgccctgaaagagcaatacggcagcagctgggccgcc
atcaaccctgagtccgtcgctcgcatgcgcgcccagaaccgcttcaagaccggtctggaa
atcgctcagtacaccgccgacatcatgcgcaaggacatggccgagtacgacgccgactcg
tccgtctacacgcagtccctcggctgctggcacggcttcattggtcagcagaagctgatc
tccatcaagaagcacctgaagaccaccaacaagcgctacctctacctgtccggctggatg
gttgctgctctgcgttccgagttcggcccgctgccggaccagtccatgcacgagaagact
gccgtttccgacctgatcgaggagctgtacaccttcctgcgtcaggctgacagccgcgaa
ctggacctgctgttcaccgccctggacgctgctcgtgaagctggcgacaacgccaaggct
gccgagatccagaaccagatcgacaactacgaaacccacatcgtaccgatcatcgctgac
atcgacgctggcttcggtaacccggaagccacctacctgctggccaagcgcatgatcgaa
gcaggcgcttgctgcatccagatcgagaaccaggtttccgacgagaagcagtgcggccac
caggacggtaaagtaaccgttccgcacgccgacttcctcgccaagatcgctgccgttcgt
tacgccttcctcgagctgggcatcgacaacggcgtgatcgttgctcgtaccgactccctg
ggtgccggcctgaccaagcagattgccgtgaccaaagagccgggcgacctgggcgacctg
tacaactccttcctggattgcgaagaaatctccgaagccgagctgggcaatggcgacgtc
gtaatcaagcgcgaaggcaagctgctgcgtccgaagcgtctgccgtccaacctgttccag
ttccgcgctggcaccggcgaagaccgctgcgttctggactgcatcacctcgctgcagaac
ggcgccgacctgctgtggatcgaaaccgagaagccgcacgttggccagatcaaggccatg
gttgaccgcatccgcgaagtcatcccgaacgccaagctggtctacaacaacagcccgtcc
ttcaactggaccctgaacttccgtcagcaggtgttcgacgctttcgttgccgaaggcaag
gacgtgtccgcctacgaccgcgccaagctgatgagcgtcgagtacgacgaaaccgagctg
gcccaggttgcagacgagaagatccgtaccttccagcgcgacggttcggctcacgccggc
atcttccaccacctgatcaccctgccgacctaccacactgctgctctgtcgaccgacaac
ctggccaagggctactttgccgaccagggcatgctggcctacgtcaagggcgttcagcgc
gaggaactgcgtcagggtatcgcctgcgtcaagcaccagaacatggctggctctgacatc
ggcgacaaccacaaggagtacttcgctggcgaagctgctctgaaggcaagcggcaaagac
aacaccatgaaccagttccactaa

DBGET integrated database retrieval system