KEGG   Pseudomonas stutzeri A1501: PST_2311Help
Entry
PST_2311          CDS       T00511                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PST_2311
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PST_2311
Enzymes [BR:psa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PST_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2522256..2523899
Genome map
AA seq 547 aa AA seqDB search
MGKSRCSTTLIFEGLNMSAYQDDIKAVAALKEQYGSSWAAINPESVARMRAQNRFKTGLE
IAQYTADIMRKDMAEYDADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWM
VAALRSEFGPLPDQSMHEKTAVSDLIEELYTFLRQADSRELDLLFTALDAAREAGDNAKA
AEIQNQIDNYETHIVPIIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGH
QDGKVTVPHADFLAKIAAVRYAFLELGIDNGVIVARTDSLGAGLTKQIAVTKEPGDLGDL
YNSFLDCEEISEAELGNGDVVIKREGKLLRPKRLPSNLFQFRAGTGEDRCVLDCITSLQN
GADLLWIETEKPHVGQIKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGK
DVSAYDRAKLMSVEYDETELAQVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDN
LAKGYFADQGMLAYVKGVQREELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKD
NTMNQFH
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaagtcggtgctcaaccacacttatttttgaaggattgaacatgtccgcatat
caagacgacatcaaggcagttgccgccctgaaagagcaatacggcagcagctgggccgcc
atcaaccctgagtccgtcgctcgcatgcgcgcccagaaccgcttcaagaccggtctggaa
atcgctcagtacaccgccgacatcatgcgcaaggacatggccgagtacgacgccgactcg
tccgtctacacgcagtccctcggctgctggcacggcttcattggtcagcagaagctgatc
tccatcaagaagcacctgaagaccaccaacaagcgctacctctacctgtccggctggatg
gttgctgctctgcgttccgagttcggcccgctgccggaccagtccatgcacgagaagact
gccgtttccgacctgatcgaggagctgtacaccttcctgcgtcaggctgacagccgcgaa
ctggacctgctgttcaccgccctggacgctgctcgtgaagctggcgacaacgccaaggct
gccgagatccagaaccagatcgacaactacgaaacccacatcgtaccgatcatcgctgac
atcgacgctggcttcggtaacccggaagccacctacctgctggccaagcgcatgatcgaa
gcaggcgcttgctgcatccagatcgagaaccaggtttccgacgagaagcagtgcggccac
caggacggtaaagtaaccgttccgcacgccgacttcctcgccaagatcgctgccgttcgt
tacgccttcctcgagctgggcatcgacaacggcgtgatcgttgctcgtaccgactccctg
ggtgccggcctgaccaagcagattgccgtgaccaaagagccgggcgacctgggcgacctg
tacaactccttcctggattgcgaagaaatctccgaagccgagctgggcaatggcgacgtc
gtaatcaagcgcgaaggcaagctgctgcgtccgaagcgtctgccgtccaacctgttccag
ttccgcgctggcaccggcgaagaccgctgcgttctggactgcatcacctcgctgcagaac
ggcgccgacctgctgtggatcgaaaccgagaagccgcacgttggccagatcaaggccatg
gttgaccgcatccgcgaagtcatcccgaacgccaagctggtctacaacaacagcccgtcc
ttcaactggaccctgaacttccgtcagcaggtgttcgacgctttcgttgccgaaggcaag
gacgtgtccgcctacgaccgcgccaagctgatgagcgtcgagtacgacgaaaccgagctg
gcccaggttgcagacgagaagatccgtaccttccagcgcgacggttcggctcacgccggc
atcttccaccacctgatcaccctgccgacctaccacactgctgctctgtcgaccgacaac
ctggccaagggctactttgccgaccagggcatgctggcctacgtcaagggcgttcagcgc
gaggaactgcgtcagggtatcgcctgcgtcaagcaccagaacatggctggctctgacatc
ggcgacaaccacaaggagtacttcgctggcgaagctgctctgaaggcaagcggcaaagac
aacaccatgaaccagttccactaa

DBGET integrated database retrieval system