KEGG   Pseudomonas stutzeri A1501: PST_2349Help
Entry
PST_2349          CDS       T00511                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:psa00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2570060..2571169
Genome map
AA seq 369 aa AA seqDB search
MRGDARPVSTAPISPCCTFRLPSTVMIRPCSEACPMLTDALARFPRLELITTPTPLEHLP
RLSRHLGRDIWIKRDDLTPLALGGNKARKLEYLGADALALGADVLVTAGAIQSNHVRQTA
ALAARQGLGCLALLENPLGTNEDNYLGNGNRLLLDLFGSEVEAVANLDNADELLQASAER
LRSAGRRPYVVPIGGSNALGALGYVRAGLELAEQMHGAGEDFAAVALASGSAGTHSGLAL
ALAHARPSSRVVGVTVSRPQATQRPKVEGLLQRTAELLGVQVPAGLQVELWDQYFAPRYG
EPNAATLAAIRLLAEQEGVLLDPVYTGKAFAGLLNGLARGAFPGTGPLLFLHTGGAPALF
AYYPWALGA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggcgatgcgcggcctgtcagcactgcgcccatatcgccttgctgcaccttcaga
ttgccttctacagtaatgattcgtccctgttcagaagcttgcccgatgctcaccgacgcc
ctcgcccgcttcccgcgccttgaattgatcaccacccccacgcccctggaacacttgccg
cggctgtcgcgtcacctgggtcgtgatatctggatcaagcgcgacgacctcaccccgctg
gccctcggtggcaacaaggcgcgcaagctcgaatacctcggtgccgacgccctggctctg
ggcgccgatgtgctggtaaccgccggtgccatccaatccaaccatgtgcgccagaccgca
gccctggcggccagacagggtcttggctgcctggcgctgctggagaatccgctgggcacg
aacgaggacaactacctgggcaatggcaaccgcctgctgctcgacctgttcggcagcgag
gtcgaagcggtcgccaacctggataacgccgatgagttgctgcaggcgtcggccgagcgt
ctgcgcagcgctgggcgcagaccctacgtggtgcccatcggtggctccaatgcgcttggt
gcgttgggctatgtacgcgccggcctggagctggccgagcagatgcatggcgcgggcgag
gattttgccgccgtggccctcgcgtccggcagcgccggaacccacagcggcctggcgctg
gcgctggcgcatgcccggccgagcagccgggtggtcggggtcacggtatcgcggccacag
gcgacacagcggcccaaggtcgaggggctgctgcagcgcaccgccgagctgctcggcgtc
caggttccagcgggattgcaggtcgaactgtgggaccagtatttcgccccgcgctacggt
gaaccgaatgccgccactctggccgcgatccgcctgctggccgaacaggaaggcgtgctg
ctcgatccggtttataccggtaaggccttcgccggcctgctcaacgggctggcccggggc
gccttccccggaacgggcccgctgctgtttctgcacaccggtggtgccccggcattgttc
gcctattatccatgggcactgggtgcataa

DBGET integrated database retrieval system