KEGG   Pseudomonas stutzeri A1501: PST_2443Help
Entry
PST_2443          CDS       T00511                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PST_2443 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PST_2443 (glk)
   00052 Galactose metabolism
    PST_2443 (glk)
   00500 Starch and sucrose metabolism
    PST_2443 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PST_2443 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PST_2443 (glk)
   00524 Butirosin and neomycin biosynthesis
    PST_2443 (glk)
Enzymes [BR:psa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PST_2443 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2669760..2670722)
Genome map
AA seq 320 aa AA seqDB search
MKTALVGDIGGTNARFALWRDQRIEQIRVLPTADHARPELAIRAYLDEVGQPLDALEAVC
LACAGPVSGDHFRFTNNHWQLSRQAFCRELGLKDLLLINDFTAMALGMTRLRDDERVTVR
EGEPEPGRPRLVIGPGTGLGVAGLLPLVGGGWRALPGEGGHICLPIGSEREAAIWTQLHR
AQGHVNAEAVLSGPGLLTLYRACCALDGRAAEHDSPAGITKAALAGEPYAVAVLEQFCRW
LGRIVGDNVLTLGARGGVYIVGGVVPRFAEFFMHSGFCDALCEKGQMSGYFDRLPVWLVT
APYPGLEGAGVALQSLLEGV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagcgctggttggcgacatcggtggtaccaatgcacgcttcgcgctgtggcgc
gatcagcggatcgagcagattcgcgtgctgcccacggcagaccatgcgcgtccggagctg
gcaatccgcgcctacctcgacgaggtgggccagccgctggatgcgctggaagcagtatgc
ctggcctgtgccgggccggtgagcggcgatcacttccgcttcaccaacaaccactggcag
ctgagccgacaggcgttctgccgcgaactgggcctgaaggatctgctgctgatcaacgac
ttcaccgccatggccctgggtatgacccggctgcgcgatgacgagcgcgtcacggtccgc
gagggcgagcctgaacccggccggccgcgtctggtcataggccccggcaccgggttgggg
gttgccgggctgctgccgctggtgggcggcggctggcgcgcgttgccgggcgagggcggg
catatctgtctgccgatcggcagcgagcgcgaggcggcgatctggacccagctgcaccgc
gcacagggccacgtgaatgccgaagccgtgcttagcgggccgggtttgctgacgctctat
cgtgcctgttgcgcgctggatggccgagcggccgaacacgactccccggctgggatcacc
aaggccgcgctggctggcgagccgtacgccgtggccgtgctggagcagttctgccgctgg
cttgggcgcatcgtcggcgacaacgtgctgacgctcggtgcacgcggcggggtatatatc
gtcggcggcgtggtaccgcgcttcgccgagttcttcatgcacagcggcttttgcgacgcc
ctgtgcgagaagggccaaatgagtggctatttcgatcgcctgccggtatggctggtgacc
gcgccttatccgggcctggaaggcgccggcgtggcgttgcaatcgctgctggagggcgtc
tag

DBGET integrated database retrieval system