KEGG   Pseudomonas stutzeri A1501: PST_2494Help
Entry
PST_2494          CDS       T00511                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2720853..2721935
Genome map
AA seq 360 aa AA seqDB search
MTRHSNRPAMRSTRLAVALAAALSAVGVCAADWPVNDEGGLALHGVNISGAGFAPHITPG
KNGTHYFYPEKKHFKYYADQGIRLIRFPFIWERVQHSLDSGLNFDQIRLLKKTLDLAAQN
GQKVILDMHNYGRYHGELIGSSKVPYEAYASVWRKLAERFKGHPGLLGYDIMNEPHSTVG
LWPGAAQAAVDAIREVDDQTLIFIEGERWSSAYHWPLVNANFLINDPADRLIYEAHLYFD
DDFSGKYMAQTSRNIDPMIGVERARPFIEWLQKHGQKGFLGEYGIPDDLPEAAQAMDNLL
AYLNDNCVPSAYWAGGPGWGTYKLAIEPRNGKDRPQMELMRKHLANDCTAIGPTPAQIAD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccagacactccaaccggcctgcaatgcgctcgacccgactggcagtggccctggcc
gccgcgctgtcggctgtcggcgtgtgcgccgccgactggcctgtcaatgacgaaggaggc
ctggccctgcacggggtcaacatctccggtgccggcttcgccccgcacatcacgccgggc
aagaacggcactcactacttctaccccgagaagaaacacttcaagtactacgccgatcag
ggcatccgcctgatccgctttccgttcatctgggagcgcgtgcagcactcgctcgattcc
ggattgaacttcgaccagatccggttgttgaagaagaccctagatctggccgcacagaac
ggccagaaggtcattctggacatgcacaactatggtcgttaccacggcgaactcatcggc
tcgagcaaggtgccctacgaagcctatgcctcggtatggcgcaagctggccgagcgcttc
aaaggtcacccgggcctgctcggctacgacatcatgaacgagccgcacagcaccgtgggc
ctctggccgggcgcagcccaggcggcggtcgatgcgatccgcgaagtcgacgaccagacg
ctgatcttcatcgagggcgagcgctggtcgagcgcctatcactggccgctggtgaacgcc
aatttcctgatcaacgacccggccgaccgcctcatctacgaggcgcacctgtacttcgac
gacgacttctccggcaagtacatggcccagaccagccgaaacatcgatccgatgatcggc
gtcgaacgcgcgcggccattcatcgagtggctgcagaagcatggccagaaaggcttcctc
ggcgagtacggcatccccgacgacctgcccgaagcggcgcaagcgatggacaacctgctc
gcctacctgaacgacaactgcgtgcccagcgcgtactgggccggcggccccggctggggc
acctacaagcttgcgatcgagccgcgcaacggcaaagaccgcccgcagatggagctcatg
cgcaagcacctggccaacgactgcacggccatcggccctacacctgcgcaaattgctgat
tga

DBGET integrated database retrieval system