KEGG   Pseudomonas stutzeri A1501: PST_2494Help
Entry
PST_2494          CDS       T00511                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PST_2494
Enzymes [BR:psa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PST_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2720853..2721935
Genome map
AA seq 360 aa AA seqDB search
MTRHSNRPAMRSTRLAVALAAALSAVGVCAADWPVNDEGGLALHGVNISGAGFAPHITPG
KNGTHYFYPEKKHFKYYADQGIRLIRFPFIWERVQHSLDSGLNFDQIRLLKKTLDLAAQN
GQKVILDMHNYGRYHGELIGSSKVPYEAYASVWRKLAERFKGHPGLLGYDIMNEPHSTVG
LWPGAAQAAVDAIREVDDQTLIFIEGERWSSAYHWPLVNANFLINDPADRLIYEAHLYFD
DDFSGKYMAQTSRNIDPMIGVERARPFIEWLQKHGQKGFLGEYGIPDDLPEAAQAMDNLL
AYLNDNCVPSAYWAGGPGWGTYKLAIEPRNGKDRPQMELMRKHLANDCTAIGPTPAQIAD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccagacactccaaccggcctgcaatgcgctcgacccgactggcagtggccctggcc
gccgcgctgtcggctgtcggcgtgtgcgccgccgactggcctgtcaatgacgaaggaggc
ctggccctgcacggggtcaacatctccggtgccggcttcgccccgcacatcacgccgggc
aagaacggcactcactacttctaccccgagaagaaacacttcaagtactacgccgatcag
ggcatccgcctgatccgctttccgttcatctgggagcgcgtgcagcactcgctcgattcc
ggattgaacttcgaccagatccggttgttgaagaagaccctagatctggccgcacagaac
ggccagaaggtcattctggacatgcacaactatggtcgttaccacggcgaactcatcggc
tcgagcaaggtgccctacgaagcctatgcctcggtatggcgcaagctggccgagcgcttc
aaaggtcacccgggcctgctcggctacgacatcatgaacgagccgcacagcaccgtgggc
ctctggccgggcgcagcccaggcggcggtcgatgcgatccgcgaagtcgacgaccagacg
ctgatcttcatcgagggcgagcgctggtcgagcgcctatcactggccgctggtgaacgcc
aatttcctgatcaacgacccggccgaccgcctcatctacgaggcgcacctgtacttcgac
gacgacttctccggcaagtacatggcccagaccagccgaaacatcgatccgatgatcggc
gtcgaacgcgcgcggccattcatcgagtggctgcagaagcatggccagaaaggcttcctc
ggcgagtacggcatccccgacgacctgcccgaagcggcgcaagcgatggacaacctgctc
gcctacctgaacgacaactgcgtgcccagcgcgtactgggccggcggccccggctggggc
acctacaagcttgcgatcgagccgcgcaacggcaaagaccgcccgcagatggagctcatg
cgcaagcacctggccaacgactgcacggccatcggccctacacctgcgcaaattgctgat
tga

DBGET integrated database retrieval system