KEGG   Pseudomonas stutzeri A1501: PST_2535Help
Entry
PST_2535          CDS       T00511                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00480  Glutathione metabolism
psa00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PST_2535
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PST_2535
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PST_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABP80185
UniProt: A4VMI4
Position
complement(2763089..2763571)
Genome map
AA seq 160 aa AA seqDB search
MRDPLLDIPCVTIDGEHKTLADFDAKVLLVVNTASQCGFTPQYKGLEELWQRYGERGLVV
LGFPCNQFGGQEPDSEAQIATFCERRFGVSFPLFAKVEVNGGDAHPLFIELKKRAPGLLG
SKAIKWNFTKFLIADQGRTVRRYSSRTAPQALAADIEALL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatcctctgttagatattccctgcgtcaccatcgacggcgagcacaagacgctc
gccgatttcgatgccaaggtgctgctcgtggtgaacaccgccagccaatgtggtttcacg
ccccagtacaagggattggaggagctctggcagcgctacggcgagcgtggcctggtcgtg
ctcggttttccgtgcaaccagttcggcggacaggagccggatagcgaggcgcagatcgcc
accttctgcgagcgccggttcggcgtgtccttcccgttgttcgccaaggtcgaggtcaat
ggcggcgacgcccatccgctgttcatcgagctgaagaagcgcgcgcccggcctgctgggc
agcaaggcgatcaagtggaatttcaccaagttcctcatcgccgatcaggggcgcacggtg
cggcgctattcctcgcgtaccgcgccgcaggcgctggcggcggatatcgaggcgctgctc
tga

DBGET integrated database retrieval system