KEGG   Pseudomonas stutzeri A1501: PST_2690Help
Entry
PST_2690          CDS       T00511                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00300  Lysine biosynthesis
psa01100  Metabolic pathways
psa01120  Microbial metabolism in diverse environments
psa01230  Biosynthesis of amino acids
Module
psa_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PST_2690 (dapE)
Enzymes [BR:psa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PST_2690 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABP80340
UniProt: A4VMY9
Position
2915251..2916399
Genome map
AA seq 382 aa AA seqDB search
MTAPALSPTLELACELINRPSVTPLDEGCQQLMSQRLAACGFAIEPMHIEDVENFWAIRG
NEGPVLCFAGHTDVVPTGPLQAWQNPPFSARIDEQGMLHGRGAADMKGSLAAMVVAVERF
TADHPDHKGQIAFLITSDEEGPAHHGTKAVVERLRERGQRLDWCIVGEPSSTSLVGDVVK
NGRRGSLGGTLTVRGQQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQIS
NLNAGTGATNVIPGTLEAVFNFRFSTESTVEGLQQRTAAILDKHGLDWSIDWALSGLPFL
TEPGDLLDGVAKAIRSVTGRETTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQVDEHI
LASDLDVLTDIYYQTLVNLLAC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccgccctctccccgaccctcgaactggcctgcgagctgatcaaccgcccc
tccgtgacgccgctggacgaaggctgccagcagctgatgagccagcgcctggcggcttgc
ggcttcgcaatcgagccgatgcacatcgaggacgtggagaacttctgggccattcgcggc
aacgaaggcccggtgctgtgcttcgccggccataccgacgtggttcccaccggcccgctg
caggcctggcagaacccgcctttcagtgcgcgcatcgacgagcagggcatgctccacggt
cgcggcgcggcagacatgaaaggcagcctggccgccatggtcgtggcagtggaacgcttc
accgccgaccatccggaccacaagggacagatcgccttcctgatcaccagcgatgaggaa
ggcccggcgcaccacggtaccaaggcggtggtcgaacgcctgcgcgagcgcggccagcgc
ctggactggtgcatcgtcggcgaaccctcgagcaccagcctggtgggcgacgtggtgaag
aacggtcgccgcggctcgctgggcggcacgctcaccgttcgcggtcagcagggccatgtg
gcctaccctcatctggcgaagaacccgatccacctggccgcaccggcactggccgagctg
gctgccgaacactgggacgatggcaatgcgttcttcccgccgaccagcttccagatctcc
aacctgaacgccggcaccggcgccaccaacgtcatccccggcacgctggaagcggtattc
aacttccgcttctccaccgagtcgaccgtcgaaggcttgcagcaacgcaccgcggcgatc
ctcgacaagcacggtctggactggagcatcgactgggcgctgtccggcctgccgttcctc
accgagccgggtgacctgctcgacggcgtggccaaggcgatccgcagcgtcaccggccgc
gaaaccacgccgtccaccagcggcggcacctcggacggacgctttatcgccaccctgggt
acccaggtggtcgagctcggcccggtcaatgccaccatccaccaagtcgacgagcacatt
ctagccagcgatctcgatgtgctgaccgacatctactaccagaccctggtgaacctgctg
gcatgctga

DBGET integrated database retrieval system