KEGG   Pseudomonas stutzeri A1501: PST_2895Help
Entry
PST_2895          CDS       T00511                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PST_2895
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PST_2895
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PST_2895
Enzymes [BR:psa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PST_2895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3117256..3118467
Genome map
AA seq 403 aa AA seqDB search
MTSYRNGPDAKGLFGHFGGQYVAETLMPLIHELAAEYEKAKADPEFAKELAYFQRDYVGR
PSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLAKRMGKQRIIAETGAGM
HGVATATVAARFGMQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVHNTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQMMEKEGRLPDSLVACIGGG
SNAMGLFHPFLDDASVKIIGVEAAGHGIETGQHAASLNGGVPGVLHGNRTFLLQNEDGQI
IDAHSISAGLDYPGIGPEHAWLHDIGRVEYTSITDKEALKAFHTCCRLEGIIPALESSHA
LAEVFKRAPGLPKDHLMVVNLSGRGDKDMQTVMHHYDEQEEHI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacctcataccgcaacggccctgacgccaagggcctgttcggccacttcggtggtcag
tacgtcgccgaaacgctgatgccgctcatccacgagctggccgccgagtacgaaaaagcc
aaggccgaccccgagttcgccaaggagctcgcctacttccagcgcgactacgtgggccgc
ccctcgccgctgtacttcgccgagcgcctgaccgaacactgcggcggcgcgaagatctac
ctcaagcgcgaagagctcaaccacaccggcgcgcacaagatcaacaactgcatcggccag
atcctgctggccaagcgcatgggcaagcagcgcatcatcgccgagaccggcgccggcatg
cacggcgtggccactgccaccgtggccgcgcgcttcggcatgcagtgcgtgatctacatg
ggcaccaccgacatcgaccgccagcaggccaacgtcttccgcatgaagctcctgggcgcc
gaagtgattccggtcaccgccggcaccggcaccctgaaggacgcgatgaacgaagccctg
cgcgactgggtgaccaacgtccacaacaccttctacctgatcggcaccgtcgccggaccg
cacccctaccccgccatggtccgcgacttccaggccgtgatcggcaaggaaacccgcgag
cagatgatggaaaaggaaggtcgcctgcccgactcgctggtggcctgtatcggtggcggc
tccaatgccatgggcctgttccatccgttcctggatgacgccagtgtgaagatcatcggc
gtcgaggcggccgggcacggtatcgagaccggccagcacgcggcgagcctgaacggcggc
gtacccggcgtactgcacggcaaccgcaccttcctcctgcagaacgaggatggccagatc
atcgacgcccactcgatctccgccggcctggactaccccggcatcggcccggaacacgcc
tggctgcacgacatcggccgcgtcgagtacacctcgatcaccgacaaggaagcgctcaag
gctttccatacctgctgccgcctggaaggcatcatcccggcgctggagtcctcccacgcg
ctggctgaagtattcaagcgcgcgcctggtctgccgaaggatcacctgatggtggtcaac
ctctccggccgcggcgacaaggacatgcagaccgtcatgcaccactacgacgaacaggaa
gaacatatatga

DBGET integrated database retrieval system