KEGG   Pseudomonas stutzeri A1501: PST_2896Help
Entry
PST_2896          CDS       T00511                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PST_2896 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PST_2896 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PST_2896 (trpA)
Enzymes [BR:psa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PST_2896 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3118464..3119273
Genome map
AA seq 269 aa AA seqDB search
MSRLLTRFDELKQQNRAALVTFITAGDPDYATSLQILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALAAKQDLAKTLQMVREFRQDDQTTPIVLMGYFNPIHKMGVERFIAEAVE
AGVDGLIVVDLPPEHNEDLCDPAQAAGIDFIRLTTPTTDDKRLPVVLNGSSGFVYYVSVA
GVTGAGSATLEHVEEAVARLKRHTELPVCVGFGIRTPEQAAAIARLTEGVVVGSALIDQI
ANAKSNAQAVEGVLELCRQISTGVRSARA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgctgacgcgcttcgacgagctgaaacaacagaaccgcgccgcactggtg
accttcatcaccgccggcgatccggactacgccacctcgctgcagatcctcaagggcctg
ccggccgcgggtgccgacgtcatcgaactgggcatgcccttcaccgacccgatggccgac
ggcccggcgattcagctggccaacatccgcgccctggccgccaagcaggacctggccaag
acgctgcagatggttcgtgaattccgccaggacgaccagaccaccccgatcgtgctgatg
ggctacttcaaccccatccacaagatgggcgtggagcgcttcatcgccgaggcggtggaa
gccggcgtcgacggcctgatcgtggtcgacctgccgccggagcacaacgaagacctctgc
gacccggcccaggccgcgggcatcgacttcatccgcctgaccaccccgaccaccgatgac
aagcgcctgccggtggtactcaacggcagctccggcttcgtctattacgtctcggtggcc
ggcgtgaccggtgccggttcggcgacgctcgagcatgtcgaggaagccgtggcgcgcctc
aagcgtcataccgagctgccggtgtgcgtcggcttcggcatccgcacaccggaacaggcc
gccgccatcgcccggctgaccgaaggggtggtagtgggctcggcgctgatcgatcagatc
gccaatgccaagagcaacgcacaggccgtcgaaggcgtgctggaactgtgccgccagatc
agtaccggcgtgcgcagcgcccgcgcctga

DBGET integrated database retrieval system