KEGG   Pseudomonas stutzeri A1501: PST_2896Help
Entry
PST_2896          CDS       T00511                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:psa00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:psa00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3118464..3119273
Genome map
AA seq 269 aa AA seqDB search
MSRLLTRFDELKQQNRAALVTFITAGDPDYATSLQILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALAAKQDLAKTLQMVREFRQDDQTTPIVLMGYFNPIHKMGVERFIAEAVE
AGVDGLIVVDLPPEHNEDLCDPAQAAGIDFIRLTTPTTDDKRLPVVLNGSSGFVYYVSVA
GVTGAGSATLEHVEEAVARLKRHTELPVCVGFGIRTPEQAAAIARLTEGVVVGSALIDQI
ANAKSNAQAVEGVLELCRQISTGVRSARA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgctgacgcgcttcgacgagctgaaacaacagaaccgcgccgcactggtg
accttcatcaccgccggcgatccggactacgccacctcgctgcagatcctcaagggcctg
ccggccgcgggtgccgacgtcatcgaactgggcatgcccttcaccgacccgatggccgac
ggcccggcgattcagctggccaacatccgcgccctggccgccaagcaggacctggccaag
acgctgcagatggttcgtgaattccgccaggacgaccagaccaccccgatcgtgctgatg
ggctacttcaaccccatccacaagatgggcgtggagcgcttcatcgccgaggcggtggaa
gccggcgtcgacggcctgatcgtggtcgacctgccgccggagcacaacgaagacctctgc
gacccggcccaggccgcgggcatcgacttcatccgcctgaccaccccgaccaccgatgac
aagcgcctgccggtggtactcaacggcagctccggcttcgtctattacgtctcggtggcc
ggcgtgaccggtgccggttcggcgacgctcgagcatgtcgaggaagccgtggcgcgcctc
aagcgtcataccgagctgccggtgtgcgtcggcttcggcatccgcacaccggaacaggcc
gccgccatcgcccggctgaccgaaggggtggtagtgggctcggcgctgatcgatcagatc
gccaatgccaagagcaacgcacaggccgtcgaaggcgtgctggaactgtgccgccagatc
agtaccggcgtgcgcagcgcccgcgcctga

DBGET integrated database retrieval system