KEGG   Pseudomonas stutzeri A1501: PST_3059Help
Entry
PST_3059          CDS       T00511                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PST_3059 (holC)
   00240 Pyrimidine metabolism
    PST_3059 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PST_3059 (holC)
   03430 Mismatch repair
    PST_3059 (holC)
   03440 Homologous recombination
    PST_3059 (holC)
Enzymes [BR:psa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PST_3059 (holC)
DNA replication proteins [BR:psa03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PST_3059 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3288335..3288754
Genome map
AA seq 139 aa AA seqDB search
MTRIEFYVLPDDNPLGRLRAACQLAAKGWQHGLQVFVRCSDEDQSTRLDELLWSFRAERF
IPHEQYAEEVQAPVVIGLEQEPPTAQGLLINLAPTLSAHIDRFSRVIEIVNQEPQLLTAC
RENFRLYRRQGYDPQRVEL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcatcgagttctacgtgctgccggacgacaacccgctcgggcggctgcgcgcg
gcctgccagctggcagccaaaggctggcaacatggcctgcaggtattcgtccgctgcagt
gacgaggaccagtcgacccggctcgacgagctgctctggagctttcgcgcggaacgtttc
atcccgcacgagcagtacgccgaggaggtgcaggcgccagtggtcatcgggctcgaacag
gaaccaccgaccgcccagggcctgctgatcaacctggcaccgacactctcggcgcatatc
gaccgtttcagccgtgtcatcgagatcgtcaaccaggagccgcagctgctgaccgcctgc
cgggagaattttcgcctgtatcggcgccagggctatgatccacaaagggtcgagctctaa

DBGET integrated database retrieval system