KEGG   Pseudomonas stutzeri A1501: PST_3059Help
Entry
PST_3059          CDS       T00511                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:psa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:psa00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:psa03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:psa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3288335..3288754
Genome map
AA seq 139 aa AA seqDB search
MTRIEFYVLPDDNPLGRLRAACQLAAKGWQHGLQVFVRCSDEDQSTRLDELLWSFRAERF
IPHEQYAEEVQAPVVIGLEQEPPTAQGLLINLAPTLSAHIDRFSRVIEIVNQEPQLLTAC
RENFRLYRRQGYDPQRVEL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcatcgagttctacgtgctgccggacgacaacccgctcgggcggctgcgcgcg
gcctgccagctggcagccaaaggctggcaacatggcctgcaggtattcgtccgctgcagt
gacgaggaccagtcgacccggctcgacgagctgctctggagctttcgcgcggaacgtttc
atcccgcacgagcagtacgccgaggaggtgcaggcgccagtggtcatcgggctcgaacag
gaaccaccgaccgcccagggcctgctgatcaacctggcaccgacactctcggcgcatatc
gaccgtttcagccgtgtcatcgagatcgtcaaccaggagccgcagctgctgaccgcctgc
cgggagaattttcgcctgtatcggcgccagggctatgatccacaaagggtcgagctctaa

DBGET integrated database retrieval system