KEGG   Pseudomonas stutzeri A1501: PST_3112Help
Entry
PST_3112          CDS       T00511                                 

Definition
(GenBank) transthyretin family protein
  KO
K07127  5-hydroxyisourate hydrolase [EC:3.5.2.17]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00230  Purine metabolism
psa01100  Metabolic pathways
psa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PST_3112
Enzymes [BR:psa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.17  hydroxyisourate hydrolase
     PST_3112
Transporters [BR:psa02000]
 Other Transporters
  Others
   PST_3112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transthyretin MG1 Acyltransferase DUF4198
Motif
Other DBs
NCBI-ProteinID: ABP80750
UniProt: A4VP49
Position
3350392..3350802
Genome map
AA seq 136 aa AA seqDB search
MKSLRSIAAGLMLSGLSGLTLAAGNPLSVHVLNLENGLPSPDVRVTLEQRQGDAWKSLNS
GETNAQGRITALYPEGKTLEKGTYRVTFKTGDWFATQKASTFFLEVPVIFEADGSVEHYH
IPLLLSPYGFSTYRGN
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactacgttcaattgccgccggcttgatgctcagtggcctgtccggtctcacc
ctcgcagctggcaacccgctcagcgtgcacgtgctgaacctggaaaacggtctgccctcg
ccggatgtgcgcgtcaccctggaacaacgtcagggtgacgcctggaaatcactcaacagc
ggcgagaccaacgcgcagggtcggatcacggcgctctacccggaaggcaagacgctggaa
aaaggcacctatcgcgtcaccttcaagaccggcgactggttcgccacgcagaaggccagc
acctttttcctcgaagttccggtgatcttcgaagccgatggcagcgtcgagcactaccac
atcccgctgctgctgagcccctacggcttctccacctaccgcggcaactga

DBGET integrated database retrieval system