KEGG   Pseudomonas stutzeri A1501: PST_3112Help
Entry
PST_3112          CDS       T00511                                 

Definition
transthyretin family protein
Orthology
K07127  
5-hydroxyisourate hydrolase [EC:3.5.2.17]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PST_3112
Enzymes [BR:psa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.17  hydroxyisourate hydrolase
     PST_3112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3350392..3350802
Genome map
AA seq 136 aa AA seqDB search
MKSLRSIAAGLMLSGLSGLTLAAGNPLSVHVLNLENGLPSPDVRVTLEQRQGDAWKSLNS
GETNAQGRITALYPEGKTLEKGTYRVTFKTGDWFATQKASTFFLEVPVIFEADGSVEHYH
IPLLLSPYGFSTYRGN
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactacgttcaattgccgccggcttgatgctcagtggcctgtccggtctcacc
ctcgcagctggcaacccgctcagcgtgcacgtgctgaacctggaaaacggtctgccctcg
ccggatgtgcgcgtcaccctggaacaacgtcagggtgacgcctggaaatcactcaacagc
ggcgagaccaacgcgcagggtcggatcacggcgctctacccggaaggcaagacgctggaa
aaaggcacctatcgcgtcaccttcaagaccggcgactggttcgccacgcagaaggccagc
acctttttcctcgaagttccggtgatcttcgaagccgatggcagcgtcgagcactaccac
atcccgctgctgctgagcccctacggcttctccacctaccgcggcaactga

DBGET integrated database retrieval system