KEGG   Pseudomonas stutzeri A1501: PST_3186Help
Entry
PST_3186          CDS       T00511                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:psa00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3433209..3434063
Genome map
AA seq 284 aa AA seqDB search
MLTLPAPAKLNLMLHIVGRRADGYHELQTLFQFLDHGDELSFSPREDGEIRLHTELPGVD
HDSNLIVRAARLLQHESGCPQGADIHLLKRLPMGGGIGGGSSDAATALLGLNHLWQLHLE
EDQLAELGLTLGADVPVFVRGRAAFAEGVGERLQPVELPEPWFLVIAPQVSVSTAEIFAD
PELTRNTPAITVRSLLAGGGHNDCQPIVEKRYPEVRNALSLLNKFVPASMTGTGACVFGS
FPNEGEADKVRRQLPDTLPSFVARGRNVSMLHRCLEKLAQEVSA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgctaccagcgcccgccaaactcaatctgatgctgcacatagtcgggcgccgc
gccgacggttaccacgagttgcagacgctattccagtttctcgaccatggtgacgaactc
agcttcagcccgcgtgaagacggcgaaatccgcctgcataccgagctgccgggggtcgat
cacgacagcaacctgatcgtccgcgcagcgcgcctgctgcagcatgagagcggttgcccg
caaggtgccgacattcatctgctcaagcggctgcccatgggcggtggtattggcggtggc
agctccgacgcggcgaccgccctgctcggcctgaaccacctgtggcagctgcatctggag
gaagaccagctggccgagctagggctaaccctgggcgccgatgtcccggtattcgttcgc
ggccgggcagcctttgccgagggggttggcgagcgtctgcaaccggtcgaattacccgaa
ccttggttcctcgtaatcgcgccgcaagtctctgttagtacagcggaaatatttgccgac
ccagagttgacacgtaataccccggccattacagttcgcagccttcttgcagggggcggt
cataatgactgtcagccgatcgtcgagaagcgttatccagaagttcgtaacgctttgagc
ttgttgaacaaattcgttccggcaagcatgactggcactggagcttgtgtgtttgggagc
ttcccaaacgaaggcgaggctgataaagtccgccgccaacttccagacactttgccaagt
ttcgtggcccgcggtcgtaacgtttcgatgttgcaccgatgccttgaaaaactggcgcag
gaagtaagtgcgtag

DBGET integrated database retrieval system