KEGG   Pseudomonas stutzeri A1501: PST_3295Help
Entry
PST_3295          CDS       T00511                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PST_3295 (folK)
Enzymes [BR:psa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PST_3295 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3567392..3567943
Genome map
AA seq 183 aa AA seqDB search
MPPTRPTEMERVYIGLGSNLADPQQQLRGALQALAELPGSRLAAVSSLYASDPLGPADQP
RYVNAVAALETDLEPLALLDALQRIELAQGRERKAERWGPRTLDLDILLFGERLIDQPRL
QVPHYHMQARAFVLYPLAEIAPPELVLPDGRRLVNLLAACPFRGLERLTNTSVTCAVTNV
TRR
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaacccggccgactgagatggagcgcgtctacatcggcctgggcagcaacctg
gccgatccccagcagcagctgcgtggtgccctgcaggctctggccgagctgccaggtagc
aggctggctgcagtctcctccctctatgccagcgacccgctcgggcccgccgaccagcca
cgctacgtcaacgcggttgcggcactggagaccgacctcgagccgctggcgctgctcgat
gccctgcagcgcatcgaactggcgcagggccgcgaacgcaaggccgaacgctggggcccg
cgcaccctggacctggatatcctgctgttcggcgagcgactgatcgaccagccgcgcctc
caggttccgcactatcacatgcaggctcgggcgttcgtgctctacccgctggccgagatc
gctccgccggagctggtactgcccgatgggcgacggctcgtcaacctgctcgcggcctgc
ccgttccgcgggctggagcggctcaccaatacgagtgtcacctgcgcggtaacgaacgta
acgcgcaggtaa

DBGET integrated database retrieval system