KEGG   Pseudomonas stutzeri A1501: PST_3316Help
Entry
PST_3316          CDS       T00511                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00010  Glycolysis / Gluconeogenesis
psa00051  Fructose and mannose metabolism
psa00562  Inositol phosphate metabolism
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01130  Biosynthesis of antibiotics
psa01200  Carbon metabolism
psa01230  Biosynthesis of amino acids
Module
psa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psa_M00002  Glycolysis, core module involving three-carbon compounds
psa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PST_3316 (tpiA)
   00051 Fructose and mannose metabolism
    PST_3316 (tpiA)
   00562 Inositol phosphate metabolism
    PST_3316 (tpiA)
Enzymes [BR:psa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PST_3316 (tpiA)
Exosome [BR:psa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PST_3316 (tpiA)
  Exosomal proteins of bladder cancer cells
   PST_3316 (tpiA)
  Exosomal proteins of melanoma cells
   PST_3316 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABP80945
UniProt: A4VPP4
Position
complement(3587967..3588722)
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMNGTRASVAELIESFRRQALPAAVEIAVFPSFVHVSQVLDVVDGVQVSV
GAQDCALQSGFGALTGEVSADQLVDLGCEWVLVGHSERRLVLGETDEVVSQKFAAAQAGG
LKPVLCLGETLEEREAGRTLEVVARQLGQVLDDQGVEAFQSAVIAYEPVWAIGSGLTATP
EQAQEVHAAIRDQLARSDRRIAEGVRLLYGGSVKADNAAELFAMADIDGGLVGGASLKAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccccatggtagctggtaactggaaaatgaacggtacccgcgctagcgtcgca
gagctgatcgagtcttttcggcgtcaggcactgcctgcagcggttgagattgcggtgttt
ccctcctttgtgcatgtcagtcaggtcctggatgttgtcgatggggtgcaagtttccgtc
ggcgctcaggattgtgccttgcagtcgggtttcggggcgctgactggcgaggtttcggcc
gaccagttggttgatctcggttgtgagtgggtattggttgggcactccgagcgccgcctg
gtattgggtgagacggacgaggtggtcagccagaaatttgcggcagctcaggcaggcggt
ttgaagcctgtgctgtgcctcggtgagacgctcgaggagcgcgaggctggaagaacgctg
gaagtggtggcgcggcagttggggcaggttctcgatgatcaaggtgtcgaggcgttccag
tccgcagtgattgcgtatgagcccgtctgggccatcgggtctggcttgacggctacgcct
gagcaggcgcaagaggtacacgccgccattcgcgatcaactggcacgcagcgatcgtcgc
atcgccgaaggtgtaaggctgctgtatggtggcagcgtgaaggcggacaatgccgctgag
ctgttcgccatggcggatattgatggggggctggttggtggagcctctctgaaagcggat
gaattcggtgcgatctgtcgcgccgcggggaactga

DBGET integrated database retrieval system