KEGG   Pseudomonas stutzeri A1501: PST_3316Help
Entry
PST_3316          CDS       T00511                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PST_3316 (tpiA)
   01230 Biosynthesis of amino acids
    PST_3316 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PST_3316 (tpiA)
   00051 Fructose and mannose metabolism
    PST_3316 (tpiA)
   00562 Inositol phosphate metabolism
    PST_3316 (tpiA)
Enzymes [BR:psa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PST_3316 (tpiA)
Exosome [BR:psa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PST_3316 (tpiA)
  Exosomal proteins of bladder cancer cells
   PST_3316 (tpiA)
  Exosomal proteins of melanoma cells
   PST_3316 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3587967..3588722)
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMNGTRASVAELIESFRRQALPAAVEIAVFPSFVHVSQVLDVVDGVQVSV
GAQDCALQSGFGALTGEVSADQLVDLGCEWVLVGHSERRLVLGETDEVVSQKFAAAQAGG
LKPVLCLGETLEEREAGRTLEVVARQLGQVLDDQGVEAFQSAVIAYEPVWAIGSGLTATP
EQAQEVHAAIRDQLARSDRRIAEGVRLLYGGSVKADNAAELFAMADIDGGLVGGASLKAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccccatggtagctggtaactggaaaatgaacggtacccgcgctagcgtcgca
gagctgatcgagtcttttcggcgtcaggcactgcctgcagcggttgagattgcggtgttt
ccctcctttgtgcatgtcagtcaggtcctggatgttgtcgatggggtgcaagtttccgtc
ggcgctcaggattgtgccttgcagtcgggtttcggggcgctgactggcgaggtttcggcc
gaccagttggttgatctcggttgtgagtgggtattggttgggcactccgagcgccgcctg
gtattgggtgagacggacgaggtggtcagccagaaatttgcggcagctcaggcaggcggt
ttgaagcctgtgctgtgcctcggtgagacgctcgaggagcgcgaggctggaagaacgctg
gaagtggtggcgcggcagttggggcaggttctcgatgatcaaggtgtcgaggcgttccag
tccgcagtgattgcgtatgagcccgtctgggccatcgggtctggcttgacggctacgcct
gagcaggcgcaagaggtacacgccgccattcgcgatcaactggcacgcagcgatcgtcgc
atcgccgaaggtgtaaggctgctgtatggtggcagcgtgaaggcggacaatgccgctgag
ctgttcgccatggcggatattgatggggggctggttggtggagcctctctgaaagcggat
gaattcggtgcgatctgtcgcgccgcggggaactga

DBGET integrated database retrieval system