KEGG   Pseudomonas stutzeri A1501: PST_3489Help
Entry
PST_3489          CDS       T00511                                 

Definition
(GenBank) glucan 1,4-alpha-maltotetraohydrolase precursor
  KO
K22253  
glucan 1,4-alpha-maltotetraohydrolase [EC:3.2.1.60]
Organism
psa  Pseudomonas stutzeri A1501
Brite
Enzymes [BR:psa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.60  glucan 1,4-alpha-maltotetraohydrolase
     PST_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3777628..3779469)
Genome map
AA seq 613 aa AA seqDB search
MIARGLRPGHYAACNWAGEVGGRGVQGQPAGAGRRPGRRSSSSGGLAVGYPNKHKNRSIA
MSHILRAAVLAAVLLPFPALADQAGKSPAGVRYHGGDEIILQGFHWNVVREAPNDWYNIL
RQQASTIAADGFSAIWMPVPWRDFSSWSEGGKSGGGEGYFWHDFNKNGRYGSDAQLRQAA
GALGGAGVKVLYDVVPNHMNRGYPNKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFVGG
DADLNTGHPQVYGMFRDEFANLRSQYGAGGFRFDFVRGFAPERVNSWMTDSADNSFCVGE
LWKGPSEYPSWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKNGLNGNPD
PRWREVAVTFVDNHDTGYSPGQNGGQHHWPLQDGLIRQAYAYILTSPGTPVVYWSHMYDW
GYRDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVTGSQQTLVVALNSNLSNPGQVAS
GSFSEAVNTSNGQVRVWRTGAGSGGGDNGGGEPGALVSVNFRCDNGVTQPGDSVYAVGNV
SQLGNWSPASAVRLTDTSGYPTWKGRISLPAGQNVEWKCLIRNEANATLVRQWQGGANNS
VKPTEGATTAGRF
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgattgccaggggccttcggcctggccactacgccgcctgcaactgggcgggggaggtt
ggtggccggggcgtgcaggggcagcctgcgggtgccggtcgaagacccggccggcgttca
tcctcgtctggcggccttgccgtcggatacccgaacaagcacaagaaccggagtattgcg
atgagccacatcctgcgtgccgccgtattggcggcggtcctgctgccgtttcccgcactg
gccgatcaggccggcaagagcccggccggggtgcgctaccacggcggcgacgaaatcatc
ctccagggcttccactggaacgtcgtccgcgaagcgcccaacgactggtacaacatcctc
cgccaacaggcctcgacgatcgcggccgacggcttctcggcaatctggatgccggtgccc
tggcgtgacttctccagctggagcgaaggcggcaagtccggcggcggcgaaggctacttc
tggcacgacttcaacaagaacggccgctacggcagcgatgcccagctgcgtcaggcggcc
ggcgcgctaggcggtgccggggtgaaggtgctctacgacgtggtgcccaaccacatgaac
cgcggctacccgaacaaggaaatcaacctgccggccggccagggcttctggcgcaacgac
tgcgccgacccgggcaactaccccaatgactgcgatgacggcgatcgtttcgtcggcggc
gatgcggacctcaataccggtcatccgcaggtctacggcatgttccgcgacgagttcgcc
aacctgcgcagccagtacggcgccggcggcttccgcttcgatttcgtccgcggcttcgcc
ccggagcgggtcaacagctggatgaccgacagtgccgacaacagcttctgcgtcggcgag
ctgtggaaaggcccttctgaatatcccagctgggactggcgcaacacggcgagctggcag
cagatcatcaaggactggtccgatcgggccaagtgcccggtgttcgacttcgccctcaag
gagcgcatgcagaacggctcgatcgccgactggaagaacggccttaacggcaaccccgat
ccgcgctggcgcgaggtggcagtgacctttgtcgacaaccacgacaccggctactcgccc
gggcagaacggtgggcagcatcactggccgctgcaggacgggctgatccgtcaggcctac
gcgtacattctgaccagccccggcacgccggtggtgtactggtcgcacatgtacgattgg
ggctaccgcgacttcatccgccagctgatccaggtgcgtcgcgccgctggcgtgcgtgcc
gattcggcgatcagcttccacagcggctacagcggcctcgtcgccaccgtcaccggcagt
cagcagaccctggtggtggcgctcaattccaacctgagcaatcccggccaggtcgccagc
ggcagcttcagcgaagcagtcaataccagcaatggccaggtgcgggtctggcgcaccggc
gccggcagtggtggcggtgacaatggcggcggtgagcccggtgccctggtcagcgtgaac
ttccgctgcgacaacggtgtgacgcaacccggcgacagcgtctacgcggtgggcaacgtc
agccagctcggcaactggagcccggcctctgcggtgcggctgaccgataccagcggctac
ccgacctggaagggccgcatctcgctgccggccggccagaacgtggaatggaagtgcctg
atccgcaacgaggccaatgcaacgctggtgcggcaatggcagggcggggccaacaacagc
gtgaagcccaccgagggtgccaccacggcggggcggttctag

DBGET integrated database retrieval system