KEGG   Pseudomonas stutzeri A1501: PST_3499Help
Entry
PST_3499          CDS       T00511                                 

Gene name
glk-2
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00010  Glycolysis / Gluconeogenesis
psa00052  Galactose metabolism
psa00500  Starch and sucrose metabolism
psa00520  Amino sugar and nucleotide sugar metabolism
psa00521  Streptomycin biosynthesis
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01130  Biosynthesis of antibiotics
psa01200  Carbon metabolism
Module
psa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PST_3499 (glk-2)
   00052 Galactose metabolism
    PST_3499 (glk-2)
   00500 Starch and sucrose metabolism
    PST_3499 (glk-2)
   00520 Amino sugar and nucleotide sugar metabolism
    PST_3499 (glk-2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PST_3499 (glk-2)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PST_3499 (glk-2)
Enzymes [BR:psa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PST_3499 (glk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABP81127
UniProt: A4VQ76
Position
complement(3789375..3790343)
Genome map
AA seq 322 aa AA seqDB search
MRLALVGDIGGTNARFALWRNARLEAVRVLATADFATPELAVEYYLASLGLAPGSVGAAC
LACAGPVKGEQFVFTNNHWRLGRRDFCGALQLDELLLINDFAAMALGMTRVAEAQRRIIC
NGVAETGAPALVIGPGTGLGVATLLPLAGGGWQALPGEGGHVDLPLADAYEAALWQQLFA
GLGHVRAEDVLSGGGLLLLYRALCLLHDQAPRLASPAEVTAAALAGDTLAAATLEQFCVW
LGRVAGNNVLTLGARAGVYIVGGVVPRFADFFAASGFARGFASKGCMSAYLADVPVWLVT
AEYPGLEGAGVALEQALACVPG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgctggtcggtgacatcggtgggaccaacgcgcgcttcgcgctctggcgt
aacgcccggctggaagcggtgcgcgtgctggcgacggcggatttcgccacgcccgagctg
gcggtcgagtactacctggcgtcgctcggtcttgcgccgggcagcgtcggtgcggcctgc
ctggcctgtgccgggccggtcaagggcgagcagttcgtgttcaccaacaatcactggcgg
ttggggcgcagggatttctgtggtgccctgcagctggacgagctgctgctgatcaacgac
ttcgcggccatggcgctgggtatgacccgggtcgccgaagcgcagcggcgcatcatctgc
aatggggtcgcggagacgggcgcgccggcgctggtgatcgggcccggcaccgggcttggc
gtggccacgctgctgccgctggcaggcggcggctggcaggcgctgccgggagagggtggg
catgtcgacctgccgttggcggatgcctacgaggcggcgctgtggcagcagctgttcgcc
ggactcggccatgtgcgcgccgaggatgtgctcagtggcggcggcctgctgctgctgtac
cgcgcgctctgcctgctgcacgaccaggcgccgcggctggcatcgccggccgaggtcacg
gcggcagcgctggccggcgatacgctggccgcggcgaccctggaacagttctgcgtgtgg
ctcggtcgcgtggccggcaacaacgtgctgaccctgggcgcgcgcgcgggcgtgtatatc
gtcggtggtgtggtgccgcgctttgccgatttcttcgccgccagcggcttcgcccgtggc
tttgccagcaagggctgcatgagcgcttatctcgccgacgtgccggtgtggctggtgacc
gcggagtatccggggctagaaggtgccggagtggcgctggagcaggccctggcgtgcgtg
cccggctag

DBGET integrated database retrieval system