KEGG   Pseudomonas stutzeri A1501: PST_3550Help
Entry
PST_3550          CDS       T00511                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:psa00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3836779..3838692)
Genome map
AA seq 637 aa AA seqDB search
MSDKSKNNPEVLEKGGISRRNFLGASAVTGAAVAATAFGGAVMTRESWAAAVKDAQQNIH
VAPGELDDYYGFWSGGHQGEVRVLGIPSMRELMRIPVFNVDSASGWGLTNESRAIMGDSA
KFLNGDCHHPHISMTDGKYDGKYVFINDKANTRVARIRLDIMKCDKMLTVPNCQAIHGLR
LQKVPYTKYVFANAEFVIPHPNDGKVFDLQDENSYTMYNVIDAEKMEMAFQIIVDGNLDN
TDMDYTGRFTASTCYNSEKAYDLGGMMRNERDWVVVFDIEAAEKAVKAGKFITLGDSKVP
VLDGRKKGDKDSEFTRYIPVPKNPHGCNTSSDGKYFIANGKLSPTVTMIEIAKLPDLFAG
KLKDPRDTVAAEVELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMADAVRAYKGEKVEYI
KQKLDVHYQPGHIHASLCETSEADGKWLVALCKFSKDRFLPTGPLHPENDQLIDISGDVM
KLVHDGPTYAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLETDNKVIRDG
NKVRVYMTSMAPSYGVQEFTVKQGDEVTVTITNLDQIEDVSHGFVMVNHGVSMEISPQQT
SSITFVADKPGLHWYYCSWFCHALHMEMVGRMLVEPA
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaagagcaagaacaaccccgaggtgctggagaagggcggcatcagccgtcgt
aacttcctcggcgccagtgcggtgaccggcgcggccgttgcggccaccgccttcggcggc
gcggtgatgacccgcgaatcctgggccgccgcggtcaaggatgcgcagcagaatatccac
gtcgcgcccggcgagctggatgactattacggtttctggagcggcggccaccagggcgaa
gtgcgcgtgctgggcattccgtccatgcgcgagctgatgcgcatcccggtgttcaacgtc
gactccgccagcggttggggcctgaccaacgaaagccgcgcgatcatgggcgacagcgcc
aagttcctcaacggcgactgccaccacccgcacatctccatgaccgacggcaagtacgac
ggcaagtacgtgttcatcaacgacaaggccaacacccgcgtcgcgcgtatccgcctggat
atcatgaagtgcgacaagatgctgaccgtgcccaactgccaggccatccacggtctgcgc
ctgcagaaggtgccatacaccaagtacgtgttcgccaacgccgaattcgtcatcccgcac
ccgaacgacggcaaggtcttcgacctgcaggatgagaacagctacaccatgtacaacgtc
atcgatgccgagaagatggagatggcgttccagatcatcgtcgacggcaacctcgacaac
accgacatggactacaccggccgcttcaccgcgtccacctgctacaactcggaaaaggcc
tacgacctgggcggcatgatgcgcaacgagcgcgactgggtcgtggtgttcgacatcgag
gcggcggagaaggcggtcaaggccggcaagttcatcaccctgggcgactccaaggtgccg
gtgctcgacggccgcaagaagggcgacaaggacagcgagttcacccgctacatcccggtg
ccgaagaacccgcacggctgcaacacctcgtccgatggcaagtacttcatcgccaacggc
aagctgtcgccgaccgtgaccatgatcgagatcgccaagctgcccgacctgttcgccggc
aagctgaaggacccgcgcgacaccgtggcggcggaagtggaactgggcctcggcccgctg
cacaccaccttcgacggtcgcggcaacgcctacaccacgctgttcatcgacagccaggtg
gtgaagtggaacatggccgacgcggtacgcgcctacaagggcgagaaggtcgagtacatc
aagcagaagctcgatgtgcactaccagccgggccacattcatgcctcgctctgcgaaacc
agcgaagccgacggcaagtggctggtggcgctgtgcaagttctccaaggaccgcttcctg
cccaccgggccgctgcaccccgagaacgaccagctgatcgacatctccggtgacgtgatg
aagctggtgcacgacggcccgacctacgccgagccgcacgactgcatcatggcccgtcgc
gaccagatcaagaccaagaagatctgggaccgcaacgacccgttcttcgcccccaccgtg
gaaatggcgaagaaggacggcatcaacctggaaaccgacaacaaggtcatccgcgacggc
aacaaggtccgcgtctacatgacctccatggcgccgagctatggtgttcaggagttcacc
gtcaagcagggcgacgaggtcaccgtgaccatcaccaacctcgaccagatcgaggacgtg
tcccacggcttcgtcatggtcaaccacggcgtgagcatggagatcagcccgcagcagacc
tcctcgatcaccttcgtcgcggacaagccgggcctgcactggtactactgcagctggttc
tgccacgcgctgcacatggagatggtcggccgcatgctggtcgaaccggcctga

DBGET integrated database retrieval system