KEGG   Pseudomonas stutzeri A1501: PST_3560Help
Entry
PST_3560          CDS       T00511                                 

Definition
two-component hybrid sensor and regulator
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:psa02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:psa02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3849296..3853576
Genome map
AA seq 1426 aa AA seqDB search
MRKAVSSVRQHCSAAMDSLLRSAVCPLMPGSPNAPEDSMSTSPEPSVPKNSNLTRSTLQF
PVVGIGASAGGLKALITLFESMPADCGMAFVVIMHLSPKHESKADQILQKATRMPVLQVT
QPTPIERNHIYVIPPALDLSMNDGYLRLTEPQRERGVQVAIDLFFRTLADTHHTHAIGIV
LSGSGADGSVGLSRIKEQGGITLAQEPGDAEFESMPRSAIETGMVDIVLPVADIAQKLVE
LHRNMQTLLEQFRPVPAPEDGEHPAVEPGEMDYIQAQPQTKPNELALREILAALRTRTGH
DFRHYKLATVLRRIERRMQVNALPDMPSYARYLQGNPEETPALLADMLIGVTNFFRDREA
FEALERDIIPVLFEQKLATDDRALRVWAAACSTGEEAYSLAMLLTDQAAHSGVDIQTQLF
ATDIDDRALETARAGVYPEAIVTDVTPARLRQYFVKDQNQLRLQKELRERILFARHNILR
DPPFSRLDLISCRNLMIYLDRDIQIEVLRMFHFALNPGGYLFLGSSETADVCSQLFTAVD
KKNRIYRAKEVGSSLRRAPLGPVHGFTLSTPPRPPFSEPHRRHRKFSFADVHQRALEQYA
PPSVIVNQEAEIVHMSDRAGNFLRYVGGEPSLNLTTLVHPQLRLELRTALYQAAHTGKSV
EARRVRLERDGRSYYVNMVVRPFRDNEAGSDYMLVLFDEVEACMDSSTLEDPDTKDSVLT
QLEAELQHTKERLQITMEHSETSTEELRASNEELQAINEELRSATEELETSKEELQSINE
ELTTVNYELKSKVDETSKINDDLQNLISSTDIATVFVDRKMRIKWFTPRARDIFNVIGND
AGRSLFDITHRLDYPLLAKDAAEAFEELHLVEREVRDREGQHWYLARFLPYRTLDDRIEG
AVLTFIDISDRRRAEEELRAGEAHLKLLAQSTKGYAIITLDCDGLITTWNCGAELILGYR
ETEVLGQTVDIIYTEQDRQAGVPEAERQRALQHGQATDERWHARRDGSRCFLSGLLNPLV
DGTGKVIGFAKIARDLTEERQRSSEQQNELESVQAANLQKDQFFAVLSHELKHPLNLIQL
NTDLVARSQAVKNNPSLHKATQSIQNAVRSQSRIIDDLMDVSRIRTGKLKLHFATLRYQD
VLRGIEAVFAPLAQSENISFESFKPDAPIYIQADPTRLDQIIWNLLNNAWKFSKGGERIC
MQLEREGDQARLDVIDTGEGISADFLPKVFDMFGQAEMQHAQRAKHGLGIGLALVKQLVE
AHNGRIEAYSEGIGRGARFSVWLPVHLQTELELSDLANADDAGGLRGIRILLVDDSPDIL
ETMCELLQSEGAEVTTADGGARAIELAEQTPFDVIVSDIGMPEIDGHKMMAIIRQQGANR
DTPSIALTGYGTLRDVEKAMAAGFTLHLRKPIDLQALIDAVSQAVH
NT seq 4281 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaagccgtatcatccgttcggcagcactgctcggcagcgatggactccctgctt
cgttctgctgtctgccctttaatgcccggaagtcccaatgcacccgaggattcgatgagt
accagccctgagccgtccgtgccgaagaacagcaacctgacccgcagcacgctgcagttt
cccgtggtcggtatcggcgcctcggcaggcggcctcaaggcgcttatcacgctgttcgaa
agcatgccggccgattgcggcatggccttcgtggtgatcatgcacctctcgcccaaacac
gagagcaaggccgaccagatcctgcagaaggcgacccgcatgccggtgctgcaggtcacc
cagccgacgcccatcgagcgcaaccacatctacgtgattcccccggcgctggacctgtcg
atgaacgacggctacctgcgcctgaccgagccgcagcgcgagcgtggcgtgcaggtggcc
atcgacctgttcttccgcacgctggccgacacccaccacacccacgccatcggcatcgtg
ctttccggcagcggtgccgacggttcggtggggctgtcgcgcatcaaggaacagggcggc
atcaccctggcgcaggaacccggcgatgcggagttcgagtcgatgccgcgcagcgccatc
gaaaccggcatggtcgacatcgttctgccggtggccgacatcgcgcagaagctggtcgaa
ctgcaccgcaacatgcagacgctgctcgagcagttccgcccggtgccggcgcccgaggac
ggcgagcaccccgcggtcgagccgggcgagatggactacatccaggcgcaaccccagacc
aagcccaacgagctggcgctgcgcgagatcctcgccgcgctgcgcacccgcaccggccac
gatttccgccattacaagctggccacggtactgcgccgcatcgaacggcgcatgcaggtc
aatgccctgcccgacatgcccagttacgcccggtacctgcagggcaacccggaggaaacc
ccggcactgctggccgacatgctgatcggcgtgaccaacttcttccgcgaccgcgaggcc
ttcgaggcgctggaacgcgacatcatccccgtgctgttcgagcagaagctcgccaccgat
gaccgcgctctgcgggtctgggccgcggcctgctccaccggcgaggaagcctattcgctg
gccatgctgctcaccgaccaggccgcccacagcggggtcgacatccagacccagctgttc
gccaccgacatcgacgatcgcgccctggaaaccgcgcgcgccggcgtctaccccgaggcc
atcgtcaccgacgtcaccccggcccgactgcgccagtacttcgtcaaggatcagaaccag
ctgcgcctgcagaaggagctgcgcgagcgaatcctcttcgcccgtcacaacatcctgcgc
gacccgccattctcgcggctcgacctgatctcctgccgcaacctgatgatctacctggac
cgcgacatccagatcgaagtgctgcgcatgttccacttcgccctcaaccccggtggctac
ctgtttctcggcagctccgaaaccgccgacgtctgcagccagctgttcaccgcggtggac
aagaagaaccgcatctaccgcgccaaggaagtgggctcctcgctgcgccgcgcgcccctc
ggcccggtgcacggcttcaccctcagcacgccgccgcgcccgccgttcagcgagccgcac
cggcgccaccgcaagttctccttcgccgacgtgcaccagcgcgcgctcgagcagtacgcg
ccgcccagcgtcatcgtcaaccaggaggcggagatcgtgcacatgtccgaccgcgccggg
aacttcctgcgctatgtcggtggcgagccctcattgaacctgaccaccctggtgcatccc
cagttgcgcctcgaactgcgcaccgcgctgtaccaggccgcccacaccggcaagagcgtc
gaggctcggcgcgtgcgtctggagcgcgacggccgcagctactatgtgaacatggtggtg
cgcccgttccgcgacaacgaggcaggcagcgactacatgctggtgctgttcgacgaagtg
gaagcctgcatggacagcagcacactggaggatccggacaccaaggacagcgtgctgacc
cagctcgaggcggaactgcagcacaccaaggagcgcctgcagatcaccatggagcactcg
gaaacctccaccgaggaactgcgcgcctccaacgaggagctgcaggcgatcaacgaggaa
ttgcgctcggccaccgaggagctggaaaccagcaaggaagagctgcagtcgatcaacgaa
gaactcaccaccgtcaactacgagctcaagagcaaggtcgacgagaccagcaagatcaac
gacgacctgcagaacctgatctcctccaccgacatcgccacggtcttcgtcgaccgcaag
atgcgcatcaagtggttcaccccgcgtgccagggacatcttcaacgtgatcggcaacgat
gccggccgttcgctgttcgacatcacccatcggctggactacccgctgctggccaaggac
gccgccgaagccttcgaagagctgcacctggtcgagcgcgaggtgcgcgaccgcgagggc
cagcactggtacctggcgcgcttcctgccctatcgcacgctggacgaccgcatcgaaggc
gccgtgctgaccttcatcgacatcagcgaccgccgccgggccgaggaagagctacgcgcc
ggcgaagcccacctcaagctgctggcgcagagcaccaagggctacgccatcatcaccctg
gactgtgacggcctgatcaccacctggaactgcggtgccgagctgatcctgggttaccgc
gaaaccgaagtgctcggccagacggtggacatcatctacaccgagcaggatcgccaggcc
ggtgttccggaagccgaacgccagcgcgcactgcaacatggccaggccacggacgagcgc
tggcacgcccgccgcgatggcagtcggtgcttcctcagcggcctgctcaatccactggtg
gatggtacgggcaaggtcatcggcttcgccaagatcgcccgcgacctcaccgaggaacgc
cagcgcagctccgaacagcagaacgaactggagagtgtgcaagcggccaacctgcagaag
gaccagttcttcgccgtactctcccacgagctgaagcacccgttgaacctcatccagctc
aacaccgacctggtcgcccgctctcaggcggtgaagaacaacccgagcctgcacaaggcg
acgcagtcgatccagaacgcggtgcgcagccagtcgaggatcatcgacgacctgatggat
gtctcgcgcatccgcaccggcaagctcaagctgcacttcgccacgctgcgctatcaggac
gtgctgcgcggcatcgaagcggtgttcgcgccgctggcacagagcgagaacatcagcttc
gagagcttcaagccggacgcccccatctacatccaggccgacccgacacgcctggaccag
atcatctggaacctgctgaacaacgcctggaagttctccaagggtggcgaacgcatctgc
atgcaactcgagcgcgagggcgaccaggcccggctcgacgtcatcgacaccggcgaaggc
atcagcgccgactttctgcccaaggtcttcgatatgtttggccaggccgagatgcagcat
gcgcagcgtgccaagcacgggctgggcattggcctggcgctggtcaagcagctggtcgag
gcgcacaacgggcgcatcgaggcctattcggaaggcatcggccgcggcgcgcgcttcagc
gtctggctgccggtgcatctgcagaccgaactcgaactcagcgacctggccaatgccgat
gacgccggtgggctcaggggcatccgcatcctgctggtggacgactcgccggacatcctc
gaaaccatgtgcgagctgctgcaaagcgagggcgccgaggtcaccactgccgacggcggt
gcgcgggccatcgagctggccgagcagacgccgttcgatgtgatcgtctccgacatcggc
atgccggagatcgacggccacaagatgatggccatcatccgccagcagggcgccaatcgg
gacaccccgagcatcgccctgaccggctacggcaccttgcgcgacgtggaaaaggccatg
gccgcgggcttcaccctgcacctgcgcaaacccatcgacctgcaggcgctgatcgacgcg
gtgagccaggcggtgcactga

DBGET integrated database retrieval system