KEGG   Pseudomonas stutzeri A1501: PST_3898Help
Entry
PST_3898          CDS       T00511                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PST_3898
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PST_3898
   00630 Glyoxylate and dicarboxylate metabolism
    PST_3898
Enzymes [BR:psa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PST_3898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4225614..4227794
Genome map
AA seq 726 aa AA seqDB search
MTERVQVGGLQVAKVLYDFVNNEAIPGTGVDAAAFWAGADSVIHDLAPKNRALLAKRDEL
QAKIDAWHQARAGQAHDAVAYKAFLQEIGYLLPEAEDFQATTENVDEEIARMAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDAISEADGATKGPGYNEIRGNKVIAYARNFLNEAA
PLETGSHVDSTGYRIEGGKLVVSLKDGSTTGLKNPAQLQGFQGDASAPIAVLLKNNGIHF
EIQIDPASPIGQTDAAGVKDILMESALTTIMDCEDSIAAVDADDKTIVYRNWLGLMKGDL
VEELDKGGKRITRAMNPDRVYTKADGNGELTLHGRSLLFIRNVGHLMTNDAILDKAGNEV
PEGIMDGLFTSLIAIHNLKGNTTRANSRTGSMYIVKPKMHGPEEVAFATELFGRVEDVLG
LPRNTLKVGIMDEERRTTINLKACIKEARERVVFINTGFLDRTGDEIHTSMEAGPMVRKA
AMKSEKWISAYENNNVDVGLACGLQGKAQIGKGMWAMPDLMAAMLEQKVGHPLAGANTAW
VPSPTAATLHAMHYHKIDVQARQAELAKREKASIDDILTIPLAQNTNWSEEEKRNELDNN
SQGILGYMVRWVEQGVGCSKVPDINDIALMEDRATLRISSQHVANWMRHGVVTKDQVIES
LKRMAPVVDRQNQGDPLYRPMAPDFDNSVAFQAALELVLEGTKQPNGYTEPVLHRRRREF
KAKNGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgcgttcaagtcggtggcctgcaggtcgccaaagtcctgtacgacttcgtg
aacaacgaggcgattcccggtaccggcgtcgatgccgccgccttctgggctggcgccgac
agcgtgatccacgacctggcgccgaagaaccgcgccctgctggccaagcgcgacgagctg
caggccaagatcgacgcctggcaccaggcccgcgccggccaggcccatgacgccgtggcg
tacaaggccttccttcaggaaatcggctacctgctgccggaagccgaagacttccaggcc
accaccgagaacgtcgacgaagaaatcgcccgcatggccggcccgcagctggtggtgccg
atcatgaacgcgcgcttcgccctgaacgccgccaacgcccgctggggctcgctgtatgac
gcgctctacggcaccgacgccatctccgaagcggacggcgccaccaaggggccgggctac
aacgagatccgcggcaacaaggtcatcgcctatgcgcgcaatttcctcaacgaagctgca
ccgctggaaaccggctcgcacgtcgattccaccggctatcgcatcgaaggcggcaagctg
gtcgtttcgctgaaggatggcagcaccaccggcctgaagaacccggcccagctgcagggc
ttccagggcgacgccagcgcaccgatcgccgtgctgctgaagaacaacggcatccacttc
gagatccagatcgacccggccagcccgatcggccagaccgatgccgccggcgtgaaggac
atcctgatggaatcggcactgaccaccatcatggactgcgaagactccatcgccgccgtc
gacgccgacgacaagaccatcgtctaccgcaactggctcggcctgatgaagggcgatctg
gtcgaggagctggacaagggcggcaagcgcatcacccgcgccatgaacccggaccgcgtc
tacaccaaggccgacggcaacggcgagctgaccctgcacggacgctcgctgctgttcatc
cgcaacgtcggtcacctgatgaccaacgacgccatcctcgacaaggcaggcaacgaagtg
ccggaaggcatcatggacggcctgttcaccagcctgatcgccatccacaacctcaagggc
aacaccacccgcgccaacagccgcaccggctcgatgtacatcgtcaagccgaagatgcac
ggcccggaagaagtcgccttcgccaccgagctgttcggccgcgtcgaggacgttctcggc
ctgccgcgcaacaccctcaaggtcggcatcatggatgaggagcgtcgtaccacgatcaac
ctcaaggcctgcatcaaggaagcgcgcgagcgcgtggtgttcatcaacaccggcttcctc
gaccgcaccggcgacgaaatccatacctccatggaagccggcccgatggtgcgcaaggcg
gccatgaagtccgagaaatggatcagcgcctacgagaacaacaacgtggacgtgggcctg
gcctgcggcctgcagggcaaggcgcagatcggcaagggcatgtgggccatgcctgacctg
atggccgccatgctcgagcagaaggtcggccatccgctggccggcgccaacaccgcgtgg
gtaccgtcgccgaccgcagccaccctgcacgcgatgcactaccacaagatcgacgtgcag
gcgcgccaggccgaactggccaagcgcgagaaggcttcgatcgatgacatcctcaccatc
ccgctggcacagaacaccaactggagcgaggaagagaagcgcaacgagctggacaacaac
tcgcagggcatcctcggctacatggtgcgctgggtcgaacagggcgttggttgctccaag
gtgccggacatcaacgacatcgcgctgatggaagaccgtgccaccctgcgcatctccagc
cagcacgtggccaactggatgcgccacggcgtggtaaccaaggaccaggtgatcgagagc
ctcaagcgcatggccccggtggtcgaccgccagaaccagggtgacccgctgtaccgcccg
atggcgcctgacttcgacaacagcgtggccttccaggctgcgctggagctggtcctcgaa
ggcaccaagcagcccaacggctacaccgagccggtcctgcaccgtcgccgccgcgagttc
aaggccaagaacggcctgtaa

DBGET integrated database retrieval system