KEGG   Pseudomonas stutzeri A1501: PST_3959Help
Entry
PST_3959          CDS       T00511                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:psa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:psa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4295732..4296748
Genome map
AA seq 338 aa AA seqDB search
MTPTDAKRPLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAKRLSADVITLNVSTSSTSKGETLTDTLRNLEAMAADMFVV
RHADSGAAHFIAEHVSPDVAVINGGDGRHAHPTQGMLDMLTIRRHKGSFDNLSVAIVGDI
LHSRVARSNMLALRTLGCPDIRVIAPKTLLPEGIEQYGVRVFTDMNEGLRDVDVVIMLRL
QRERMQGGLLPSEGEFYKLYGLTTQRLALARPDAIVMHPGPINRGVEIESAVADGPQSVI
LNQVTYGIAIRMAVLSMAMSGQTAQRQIDSESVSEEQQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccactgacgccaagcgcccgctacagctgaacgaccaaggccagctgcgccat
tttctctccctcgacggcctgccccgcgagctgctcaccgagattctggacaccgccgac
tccttcctcgaggttggcgcgcgtgcggtgaagaaggttccgctgctacgcggcaagacc
gtctgcaacgtcttcttcgagaactccacccgcacacgtaccaccttcgaactggcggcc
aagcgcttgtcggccgacgtcatcacgctcaacgtctcgacttcctccaccagcaagggc
gagaccctcaccgacaccttgcgcaacctggaagccatggcggcggacatgttcgtggtg
cgccacgcggactccggagccgcgcatttcatcgccgagcacgtcagcccggacgtggcg
gtgatcaacggtggcgacggtcgccatgcgcacccgacccagggcatgctcgacatgctc
accatccgccggcacaagggcagcttcgacaatctgtcggtggccatcgtcggcgatatc
ctgcactcgcgggtggcgcgctcgaacatgctggccctgcgtaccctgggctgccctgac
atccgtgtgatcgcgccgaaaacgctgctgccggaaggcatcgaacagtacggcgtgcgc
gtattcaccgacatgaacgaaggcctgcgcgacgtcgacgtggtgatcatgttgcgcctg
cagcgcgaacgcatgcagggcggtctgctgcccagcgaaggcgagttctacaagctctac
ggcctgaccacacagcgcctggcgctggccaggccggacgccatcgtcatgcacccgggc
ccgatcaaccgcggcgtggagatcgagtccgcggtggccgacggcccgcagtcggtcatt
ctcaaccaggtcacctacggcatcgccatccgcatggccgtgctgtccatggcgatgagc
ggccagaccgcgcagcgccagatcgattccgaatccgtatccgaggagcagcagtga

DBGET integrated database retrieval system