KEGG   Pseudomonas stutzeri A1501: PST_4017Help
Entry
PST_4017          CDS       T00511                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psa00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:psa00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4356582..4357322)
Genome map
AA seq 246 aa AA seqDB search
MSQRRREAVVLRAISASPRFGCHSLRHLHDRTLTLRCPLRCKTVKPTNGWRCDSCLPQCV
QHRCRKTRPSDILAAMNQTRLPLAMIAALAERHVIGRDNIMPWHLPADLRHFKAMTLGKP
IIMGRKTWDSLGRPLPGRLNLVVSRQADLQLDGAETFTDLDAALVRAEQWAREQGVDELM
LIGGAQLYAQALGQAQRLYLTRIDAQPEGDAFFPVFDEHEWQCIDSQPHPAEGEAPAYRF
ETWQRR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagcggcgaagggaagcggtggtcttgcgggccatttcggcatctcctcggttt
ggatgtcacagcctgcgccacttgcatgaccggacgttgacgctgcgttgccccttgcgt
tgcaaaacggttaagccgacgaacggctggcgctgcgattcctgtttgcctcaatgtgtc
caacaccgctgcaggaagacacggccctctgatattctcgccgccatgaatcagacccgc
cttcccctcgccatgatcgctgctctcgctgagcggcacgtgatcggtcgtgacaacatc
atgccctggcatctgcccgccgatctcaggcatttcaaggccatgacccttggcaagccg
atcatcatgggtcgcaagacctgggactcgctcggccgcccgctgccggggcggctcaac
ctggtggtcagtcgccaggccgatctgcagctcgacggcgcggaaaccttcaccgatctg
gatgccgcgctggtgcgtgccgagcagtgggcgcgcgagcagggcgtcgacgagctgatg
ctgatcggcggtgcgcagctgtacgctcaggcgttggggcaggcgcagcggctttacctg
acacggatcgacgcgcagcccgagggcgatgccttcttcccggtattcgacgagcacgaa
tggcagtgcatcgacagccagccgcatccggccgagggcgaggcacctgcgtatcggttc
gagacctggcaacggcgctga

DBGET integrated database retrieval system