KEGG   Pseudomonas stutzeri A1501: PST_4032Help
Entry
PST_4032          CDS       T00511                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PST_4032 (recD)
Enzymes [BR:psa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PST_4032 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4373635..4375485)
Genome map
AA seq 616 aa AA seqDB search
MTLADLPLGPLERAFVASLQRLEPQAPEAVLLAATLCCEALAAGDVCLPLERLAGRRPWP
DVDLSMPALPVWRAQLEASTLVGTPDDYAPLTLVGDRLYLARYQAYEQQLAEQLLARTGD
APEVDEARLAESLARLFAFNQQRPDWQRLAAAQAVRRRLAVISGGPGTGKTTTVVRLLAA
LLEQPGGERLAIGLAAPTGKAAARMAEAIRNAKAELPVSDAVKEALPDEARTLHRLLGSR
GDSPRVRHDAANPLALDVLVVDEASMVDLALMAKLVAALPPKARLILLGDKDQLAAVEAG
AVFAELCEGRGFDAGAASELERITGQPVPVETPRSRLGDAVVLLTHSHRFAGDSGIGELA
RRINAGDAKGTVALLQEGRADLAWNATPSPTALIERLEQGYGGYLQAARQGDPGAAFEAF
NGFRALTAQREGPFGVTGINEALETRFRRRLGVPARERWYPGRAVMVRQNDYALGLFNGD
VGLCLKTEQGLRVFFEGDDGYRGFAPARLPSHDSAFAMTVHKSQGSEFAEVLLALPDQPS
PLLTRALFYTGITRAKRRVEIWALPARLAEAVSTRAERAAGLAERLVPAGAAADADAVPE
APIGAAPTEGDQVSLF
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgccgatctgcccctcggcccgcttgagcgcgcctttgtcgccagcctgcaa
cgcctggaaccgcaggcgcccgaagcggtgctgctcgccgccacgctgtgctgtgaggcg
ttggcggccggcgatgtctgtctaccactggaacgcctggccggaaggcgcccctggccc
gatgtcgatctcagcatgccggcgctgcccgtctggcgcgcacagctcgaagcttccacg
ctggtcggaacaccggacgactatgcgccgctgaccctggtcggcgaccggctctacctg
gcccgctaccaggcctacgaacagcagctggccgaacagctgctggcccgcaccggcgat
gcgcccgaggtggacgaagcacggctcgccgagagcctggcgcgcttgttcgccttcaat
cagcagcgccccgactggcagcgcctggccgccgcgcaggcagttcggcggcgcctggcg
gtgatctccggcgggcctggcaccggcaagaccaccaccgtggtgcgcctgctggcggcg
ctgctcgagcagcctggcggcgagcgcctggccatcggcctcgccgcacccaccggcaag
gccgcggcgcgcatggccgaggcgatccgcaacgccaaggccgagctgccggtcagcgat
gcggtgaaggaggccctgccggacgaggcgcggaccctgcaccgcctgctcggcagccgc
ggggacagcccccgcgtgcgccacgatgcggccaatccgctggcgctggacgtgctggtg
gtggacgaggcgtcgatggtcgacctggcgctgatggccaagctggtcgccgcgctgccg
ccgaaggcgcggctgatcctgctcggcgacaaggatcagctggccgccgtggaggccggt
gcggtgttcgccgaactctgcgaaggccgtggcttcgatgccggggcggcaagcgagctg
gagcgcatcaccggccagcccgtgccggtcgagacgccgcgctcgcgcctcggcgatgcg
gtggtgctgctcacccacagccaccgcttcgccggcgacagcggcatcggcgagctggcg
cggcgtatcaacgccggcgatgcgaaaggcaccgtcgcgctgctgcaggaaggtcgtgcg
gatctcgcctggaacgcgacgcccagcccgaccgccttgatcgagcggctggaacagggt
tacggcggctacctgcaggctgcgcggcagggtgatccaggcgcggcgttcgaggccttc
aatggtttccgggcgctgactgcgcaacgcgagggcccgttcggcgtgaccggtatcaac
gaggcgctggaaacgcgcttcaggcgtcgcctcggcgtgccggcccgcgaacgctggtat
cccggccgtgcggtgatggtccggcagaacgactacgcgctggggctgttcaacggcgat
gtcggcctgtgcctgaaaaccgagcagggcctgcgggtgttcttcgagggtgacgacggt
taccgcggcttcgcgccggcacggctgccgagccacgacagcgccttcgccatgaccgtg
cacaagagccagggctcggaattcgccgaggtgctgctggcattgccggatcagccgagc
ccgctgctgacccgcgcgctgttctacaccggcatcacccgcgccaagcgccgggtggag
atctgggcgctgccggcacgtctggccgaagcggtcagcacccgcgccgagcgcgccgcc
gggctggccgagcggctggttccggcgggtgccgcggccgatgccgatgcggtgccagaa
gccccgatcggtgcggcgccaaccgagggcgatcaggtcagcctgttctaa

DBGET integrated database retrieval system