KEGG   Pseudomonas stutzeri A1501: PST_4044Help
Entry
PST_4044          CDS       T00511                                 

Definition
(GenBank) response regulator containing a CheY-like receiver domain and a GGDEF domain
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
psa  Pseudomonas stutzeri A1501
Brite
Enzymes [BR:psa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PST_4044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4393525..4395450)
Genome map
AA seq 641 aa AA seqDB search
MTRLLLLLLACLLLSPTVAATAAGSAAVQTRGASTLQLGALEYVLGMPAADFDAAASDAW
PWQPLARPTLGKQPDGAWLRLSLRNGGTDARLWYLLLKWPVLDRVAVRLHYPDSGRWGAP
MLAGDALALSARPLADHHFVYPLELPPGERAVVYLQVQARETLALPLELIDEKQFVEGRL
RDVTLVSLFFGGILVIVLYNLSLLVFTRDGSYFFYVLYLLSAVFYVLSITGFGQLYLWPE
IPELSARFYGLSAALCFFTPMLFALRFLGVRRYGGWVWWVSITLTLYWGAAVLVLLLVPT
LGRYLFMESVALLHCGLTMAVTLNLWARGNSSARLFSIAWSALLIFTVVNLLALNGVLPL
NAWTLNGQLIGMFTEFVLLSMALAERINIERNRRIAAQQLALETSESLAAERALHLQAKQ
EALDLQLQANEVLEARVYERTRALEEARQGLETANAELLRLSATDALTQLANRRRFDGVL
DEEIRRARRSGSPLAVLLADIDHFKRINDSYGHPFGDECLRQVAAVLMAHCQRAGDLAAR
YGGEEFVVLLPASDQRQAVVLAERIRQDIERLQLRHGDLPVALTISLGVATLGSTCVSAE
ALLAAADAALYAAKHAGRNRVLCAPEAAIGETGPGVSPQPV
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtctgctcctgctgctgttggcctgcttgctgctgtcgcctacggtggccgcc
accgcggccggctcggcggcggtccagacacgcggcgcctcgaccctgcagctcggcgcc
ctggagtacgtgctcggcatgcccgcggcggacttcgacgcagcggccagcgatgcctgg
ccatggcaaccgctggcgcgtccgacgctgggcaagcagcccgacggtgcctggctgcgc
ctgtccttgcgcaacggcgggacggatgcgcggctctggtacctgttgctgaagtggccg
gtgctcgaccgcgtcgcggtgcgcctgcactacccggacagcgggcgctggggtgccccg
atgctggccggcgacgccctggcgctgagtgctcggccgctggccgaccatcatttcgtc
tacccactcgagctgccgccgggcgagcgagcggtggtctatctgcaggtgcaggcccgc
gaaaccctggcgttgccgctggagctgatcgacgagaagcagttcgtcgagggccgcctg
cgggacgtcaccctggtcagcctgttcttcggcggcatcttggtgatcgtgctgtacaac
ctgagcctgctggtcttcacccgtgacggcagctacttcttctacgtgctctatctgctc
agtgcggtgttctacgtgctgagcatcaccggcttcggccagctctatctctggccggaa
atacccgagctgtcggcgcgcttctacggactgtccgccgcgctgtgcttcttcacaccg
atgctgttcgccctgcgctttctcggcgtgcgccgctacggcggctgggtgtggtgggtg
tccatcacgctgacgctgtattggggcgcggcggtgctggttctgctgctggtgccgacg
ttggggcgctacctgttcatggaaagcgtcgcgctgctgcattgcgggctgaccatggcg
gtaacgctcaacctctgggcgcgtggcaattcgtcggcgcggctgttcagcatcgcctgg
agcgcgctgctgatcttcaccgtggtcaacctgctggcgctcaatggcgtgctgccgctc
aacgcctggaccttgaacggccagctgatcggcatgttcaccgagttcgtgctgctctcc
atggcgctggccgagcgcatcaacatcgagcgcaaccggcgtatcgcggcgcagcagctg
gccctggagacctccgagtcgctcgccgccgagcgcgccctgcacctgcaggccaagcag
gaggcgctggacctgcagctgcaggccaacgaggtgctggaggcgcgggtctacgagcgc
acccgcgcgctggaagaggccaggcagggactggagaccgccaacgccgaactgctgcgc
ctgagcgccaccgacgcgctgacccagctggccaaccgccggcgcttcgacggcgtgctg
gacgaggagattcgccgtgcccgccgcagcggcagcccgctggcagtgctgctggccgac
atcgatcacttcaagcgcatcaacgacagctatggccatccgttcggtgacgagtgcctg
cgccaggtggcggcggttctcatggcgcattgccagcgtgccggtgacctggcggcacgc
tatggcggcgaggagttcgtcgtgctgctgccggcatccgatcagcgccaggcggttgtg
ctggcggagcggatccgccaggacatcgagcgcctgcagctgcgccacggcgacctgccg
gtggcgttgaccatcagccttggcgtcgccacgctggggtcgacctgtgtctcggcagag
gcgctgctagccgctgcggatgcggcgctgtatgccgccaagcacgccggtcgcaatcgg
gtgctctgtgcgcccgaggcggcgatcggcgaaaccggccccggcgtcagccctcagccg
gtatga

DBGET integrated database retrieval system