KEGG   Pseudomonas stutzeri A1501: PST_4107Help
Entry
PST_4107          CDS       T00511                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PST_4107
Enzymes [BR:psa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PST_4107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4460759..4461661
Genome map
AA seq 300 aa AA seqDB search
MPVDIQRIEMNQLACWRVRRGEDELLIAEQGAQILSYRQGDAPPIIWLSEDAAFEQGQSV
RGGVPVCWPWFGDLARNPQEVQASYHGEQPAPFHGLVRALPWQLREQRGEGDTAILEFHC
PQALGALPGWPHRVELTLQIRLADELELSLSSRNVSTQAVTISQALHSYFAVGDIHQVRV
EGLAGCPYIDTLLDWQQRQQQNGDLAFNGETDRIYLQLPTTLRLVDPAWKRSIQLTTRGS
RSAVLWNPWIDKAKRLSSFADDAWQRMACIETANVLDDAVVLQPGQQHLLGVSVTAIPAR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgatatccaacgcatcgaaatgaaccagctcgcctgctggcgagtacgccgc
ggtgaggacgaactgctgatcgccgaacagggcgcgcagatcctcagctatcgccagggc
gatgcgccgccgatcatctggctcagcgaggatgccgccttcgaacagggccaatcggta
cgcggtggcgtacccgtgtgctggccatggttcggcgatctggcgcgcaacccacaagag
gtccaggcgagctaccacggcgagcaacccgcgcccttccacggcctggtgcgcgccctg
ccctggcaattgcgggagcagcgcggcgaaggcgatacggcgattctcgagttccactgc
ccgcaggcgctcggcgcactgccgggctggcctcaccgggtcgaactgacactgcagatc
cgcctggccgacgagctggagctcagcctcagcagccgcaacgttagcacgcaggcagtc
accatcagccaggccctgcacagctacttcgccgtcggcgacatccatcaggttcgcgtc
gaaggcctggccggctgcccctacatcgatacgctgctggattggcagcagcgccagcag
cagaacggagacctggcgttcaacggcgaaaccgaccgcatctacttgcagctcccgaca
acgttgaggctcgtcgacccggcatggaaacgcagcatccagctgaccacccgaggctcg
cgatcagcggtgctgtggaacccctggatcgacaaggccaagcgcctgtccagcttcgcc
gacgacgcctggcagcgcatggcctgcatcgagacagccaacgtgctggacgacgccgtg
gtcttgcagccgggccagcagcacctgttgggcgtatccgtcaccgcaatccccgcgcgc
tga

DBGET integrated database retrieval system