KEGG   Paenibacillus sabinae: PSAB_17240Help
Entry
PSAB_17240        CDS       T03064                                 

Gene name
tgl
Definition
transglutaminase (EC:2.3.2.13)
Orthology
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
psab  Paenibacillus sabinae
Brite
Enzymes [BR:psab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     PSAB_17240 (tgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
Position
complement(3724501..3725319)
Genome map
AA seq 272 aa AA seqDB search
MIIFLNGDQNGIDMSTLSGVEREIVEKKQRSPETYVYESPAALAFELNMRRRIVEAAVAL
DASGVTFVRFENTRGNRYFWSRTNKGGLLLNNGVLPSDAINDIFRNGRMYAFECATAVVV
VLYKGVLDALGEEVFNSYFRNLLLYDWQYDRDLQLTAINNREEAYPGDVQYFKNPDHDPN
KPEWQGENVIVLDKGMYYGHGIGITTTEGMITVLNRKRVPGSRTSAYLLDKTFSPDFEYL
RRLSAGRSLPSAAGRYTGYTVVIKIGSHNYRM
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgattatttttctgaacggcgaccagaacggaatcgatatgtcaacgctatcgggtgtg
gagagagagatagtggagaagaagcagagaagtcctgaaacctatgtttacgaatctccc
gctgcgctcgcatttgagctgaatatgagaaggcgcattgttgaagcggctgtcgcgctc
gatgcaagcggagtgacctttgtccggtttgagaacaccaggggcaatcgttacttttgg
tcccgtaccaataaaggaggactcctcttaaataacggggtcttaccgtccgacgcgatc
aatgatattttccggaacggccgtatgtatgcctttgagtgcgcaacagccgtggtggtt
gttttatataagggagtccttgatgcgctgggtgaagaggtatttaattcgtactttaga
aacctgctgctctatgattggcagtatgacagagatttacagttaactgcgatcaataac
agggaggaagcctatcccggtgatgtgcagtatttcaagaatcccgaccatgacccgaac
aagccggaatggcagggcgagaacgttatcgtactggacaaaggaatgtattacgggcat
ggaatcggtattaccaccaccgagggaatgattaccgttctgaacagaaagagagtgcct
ggaagcagaacatctgcttatcttctggataagacgtttagcccggactttgagtatttg
cggagattatccgcgggaagaagccttccgtcagcggcaggccgttatacaggctataca
gttgtcataaaaatcggttcgcataattacagaatgtag

DBGET integrated database retrieval system