KEGG   Paenibacillus sabinae: PSAB_21425Help
Entry
PSAB_21425        CDS       T03064                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psab  Paenibacillus sabinae
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSAB_21425
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSAB_21425
  Energy metabolism
   00680 Methane metabolism
    PSAB_21425
Enzymes [BR:psab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PSAB_21425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(4655371..4658163)
Genome map
AA seq 930 aa AA seqDB search
MTELTTTAGKVNSNNLLRRDVRFLGNILGEVLVHQGGNELLEIVEKIRETSKSLRSVFLP
ELHSEFKELINSLDPENRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGETVQPGSI
ESAIQELRERDFSPKEVWEIINGLSLELVMTAHPTEAMRRAILDIHKRISDDVTGLDNPT
LTFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETIFHVLPDVYQELE
RCLSKYYPGQNWHVPTYLRFGSWIGGDRDGNPSVTASVTIQTLRIQRIMAIREYQQIMRQ
LIQYLSFSTSIVNVTPELLESIEKDRAVVQLERSDAWRNDNEPYRIKLSYMITKTQNVLD
DKKKGTLERYSSPEELINDLNVIDRSLRHHYADYVADTYIKKLIRQVELFGFHTATLDIR
QHSQEHEKAMTEILAKMDITPDYSKLTESEKIELLEKLLNDPRPLTSPYQEYSESTEECL
EVYRTVHAAQAEYGKQCITSYLISMAEAASDILEVMVFAKEVGLFRRDKDGTVVCTLQAV
PLFETIDDLHAAPEIMRTIFNLPIYRQAVEAMSNLQEIMLGYSDSNKDGGVVTANWELRV
ALKELTAMADSYDVKLKFFHGRGGALGRGGMPLNRSILAQPASTIGGGIKITEQGEVISS
RYKMKGIAYRSLEQATSALVIAAINARTPHSDLYENKWEDICREISEISLTKYQDLIFRD
PDFLSFFKESTPLPEIGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYDNKEENLKILQHMYEHFSFFTSLVDTLQMALAKADLVIAKEYSEMSKNDEARK
RIYGQIEEEFRLTSELILKITGQQDILDNVPVIQESIRLRNPYVDPLSYLQVQLLTELRA
LRETEQDDPDLLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacttacgactaccgcaggcaaagtcaactccaataacctgctgcggcgagac
gtacggttcctgggaaacattttgggcgaagtcttggtacatcaaggcggcaatgaactg
ctggagatcgtggagaagattcgtgagaccagtaaatcgttgcgctctgtgtttttgcct
gaactgcacagcgaatttaaggaattaatcaattccctggacccggaaaaccggcatcag
gtaatccgggcattcgccatctattttcaattggtgaatatcgccgaacaaaatcatcgg
attcgccggaaaagagactatgagcgctctgcgggtgaaaccgttcagcctggttctata
gaaagcgcaattcaggaactgcgggaacgggatttttctcctaaggaagtctgggagatt
attaatggcctgtcgctggagctggtcatgaccgcccacccgacggaagcaatgcgccgt
gccattctcgatatccacaagcggatctcagacgatgtaacgggactggacaatccgacc
ttgacattccgggaacgcgagcagctgcgcgagaagctcctaaacgaggttatcaccttg
tggcagaccgacgaactgcgtgaccgtaagcctacggtgcttgatgaagtgcgtaacgga
atgtattactttcatgagacgatttttcatgtgctgccggatgtctatcaggagcttgag
cgctgtctgagcaagtattatcctggacagaattggcatgtaccgacttacctgcggttc
ggttcatggatcggcggcgaccgggacggcaacccttcggttacggcttcggttaccatt
cagacgctgcgtattcagcgcattatggctatacgggaataccagcagatcatgcgccag
ctgatccagtatttgagctttagcaccagcatcgtgaatgtcacgccggagctgctggaa
tcgattgagaaagaccgggcggttgttcaactggagcgcagcgatgcatggcgcaacgat
aacgagccttaccggatcaaactgagctacatgattacgaagacgcagaacgtgctggac
gacaagaaaaaaggtacgcttgagcgctattcttccccggaagagctgattaacgatttg
aacgttatcgaccgcagtctgcggcatcactatgccgattacgtggccgacacttatatt
aaaaaattgatccgccaggtagagttgtttggcttccatacggcgacactcgatatccgt
cagcacagccaggagcatgagaaggcaatgacggagattttggccaaaatggatatcacg
ccggattactccaagctgacggagagtgaaaagatcgagcttctggagaagctgcttaac
gatccgcggccgctgacctctccttatcaggagtacagcgaatcgacggaagaatgtctg
gaagtgtaccggaccgttcacgcggctcaggccgagtacggcaagcagtgtatcacaagc
tacctgatcagtatggcggaagcggcgagcgatattctggaggttatggtcttcgccaag
gaagtgggcttgttccgccgggacaaagacggcactgttgtctgtacactgcaggcggtt
ccgctgttcgaaacgatcgatgatcttcacgctgcgccggaaatcatgcgcacgatcttc
aatctgccgatctatcgccaggcggtagaggccatgagcaacctgcaggagatcatgctt
ggttattccgacagcaataaggacggcggcgttgtgaccgccaactgggaactgcgcgta
gcgctgaaggagcttacggccatggccgactcgtacgatgtgaagctgaagttcttccac
ggccggggcggagcgcttggccggggcggaatgccgctgaaccgcagtattctggctcag
ccggcttccaccatcggtggcgggatcaagatcaccgagcagggcgaggtcatttcctct
cgctataagatgaaaggaatcgcctaccgcagtctggagcaggcgacgtcggcccttgtc
atcgcggccattaacgcgagaaccccgcacagtgatctgtatgagaataaatgggaagat
atttgcagagaaatttccgagatatcgctgacgaagtatcaggatctgatcttccgcgat
ccggatttcctgagcttctttaaagagtcgactccgctaccggaaatcggcgagctcaat
atcggctcccgcccgtccaaacggaagaacagcgaccggttcgaggatctgcgcgcgata
ccatgggtatttgcctggacccagagccgttacctgctgcctgcttggtatgcggcagga
acggggctgcaaagcttctatgataacaaggaagagaatcttaagattcttcaacatatg
tacgagcacttctccttcttcacgagcctggttgatacgctgcaaatggcgcttgccaaa
gcggacctggtgatcgccaaggaatactcggagatgagcaagaacgatgaagctcgcaag
cggatttacggacagattgaggaagaattccgtttgacctcggagctgattttgaagata
accggccaacaggacattttggacaatgtgccggtgattcaagagtcgatccggctgcgc
aacccgtacgtcgatccgctcagctacctgcaagttcagctcttaaccgagcttagagca
ctgcgggagaccgagcaggacgatccggacctgctgcgcgaagtgctccttacgatcaac
ggaattgccgccggtcttcgcaatacgggctga

DBGET integrated database retrieval system