KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0033Help
Entry
Psyr_0033         CDS       T00246                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psyr_0033 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psyr_0033 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psyr_0033 (trpA)
Enzymes [BR:psb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psyr_0033 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(37192..38001)
Genome map
AA seq 269 aa AA seqDB search
MSRLEHRFAQLKTEGRAALVTFITAGDPGYDTSLKVLKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALDAGQTLQKTLQMVSEFRVDDQTTPIVLMGYYNPIHRFGVEAFVAQAKE
AGVDGLIIVDLPPEHDAELATPAQASGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAAAIARLADGVVVGSAFVDKI
ASAESPEHAIDGVLTLCAALAEGVRSARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctagaacatcgtttcgcccagcttaaaaccgaaggtcgtgcggcgctggtc
accttcatcaccgccggtgaccctggctacgacacctcgctgaaagtcctgaagggcctg
cctgcggcgggtgctgacgtgatcgagctgggcatgccgttcaccgatccgatggccgac
ggtgtggcgattcagctggcgactctgcgtgctctggacgctggccagactctgcagaaa
accctgcagatggtcagcgaatttcgtgtcgacgatcagaccacaccgattgtgctgatg
ggttactacaacccgatccaccgctttggcgtcgaagccttcgtggcgcaggcaaaggaa
gcaggcgttgacggtctgatcatcgttgacctgccacccgagcacgacgccgagctggcg
acgcctgcacaggcgtccggcatcgacttcatccgcctgaccacaccgaccactgacgat
gcgcgtctgccgcgtgtgctggagcgcagctccgggttcgtctactacgtgtcggttgcc
ggtgtgaccggtgcaggctcggccaccaccgagcacgtcaccgaagccatcgctcgcttg
cgccgccacaccgatctgccgatcagcgtcggtttcggtatccgcacccccgagcaggcc
gcggcgattgcgcgtctggctgacggtgtggtcgtgggctcggccttcgtcgacaagatc
gccagcgccgagtcgccggagcatgccatcgacggcgtgctgacgctgtgcgcggcactg
gccgagggcgtacgtagcgctcgtcgctga

DBGET integrated database retrieval system