KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0033Help
Entry
Psyr_0033         CDS       T00246                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00260  Glycine, serine and threonine metabolism
psb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01130  Biosynthesis of antibiotics
psb01230  Biosynthesis of amino acids
Module
psb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psyr_0033 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psyr_0033 (trpA)
Enzymes [BR:psb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psyr_0033 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG PEP_mutase KDGP_aldolase PA
Motif
Other DBs
NCBI-GeneID: 3365508
NCBI-ProteinID: YP_233145
UniProt: Q500R5
Position
complement(37192..38001)
Genome map
AA seq 269 aa AA seqDB search
MSRLEHRFAQLKTEGRAALVTFITAGDPGYDTSLKVLKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALDAGQTLQKTLQMVSEFRVDDQTTPIVLMGYYNPIHRFGVEAFVAQAKE
AGVDGLIIVDLPPEHDAELATPAQASGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAAAIARLADGVVVGSAFVDKI
ASAESPEHAIDGVLTLCAALAEGVRSARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctagaacatcgtttcgcccagcttaaaaccgaaggtcgtgcggcgctggtc
accttcatcaccgccggtgaccctggctacgacacctcgctgaaagtcctgaagggcctg
cctgcggcgggtgctgacgtgatcgagctgggcatgccgttcaccgatccgatggccgac
ggtgtggcgattcagctggcgactctgcgtgctctggacgctggccagactctgcagaaa
accctgcagatggtcagcgaatttcgtgtcgacgatcagaccacaccgattgtgctgatg
ggttactacaacccgatccaccgctttggcgtcgaagccttcgtggcgcaggcaaaggaa
gcaggcgttgacggtctgatcatcgttgacctgccacccgagcacgacgccgagctggcg
acgcctgcacaggcgtccggcatcgacttcatccgcctgaccacaccgaccactgacgat
gcgcgtctgccgcgtgtgctggagcgcagctccgggttcgtctactacgtgtcggttgcc
ggtgtgaccggtgcaggctcggccaccaccgagcacgtcaccgaagccatcgctcgcttg
cgccgccacaccgatctgccgatcagcgtcggtttcggtatccgcacccccgagcaggcc
gcggcgattgcgcgtctggctgacggtgtggtcgtgggctcggccttcgtcgacaagatc
gccagcgccgagtcgccggagcatgccatcgacggcgtgctgacgctgtgcgcggcactg
gccgagggcgtacgtagcgctcgtcgctga

DBGET integrated database retrieval system