KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0034Help
Entry
Psyr_0034         CDS       T00246                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00260  Glycine, serine and threonine metabolism
psb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01130  Biosynthesis of antibiotics
psb01230  Biosynthesis of amino acids
Module
psb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psyr_0034
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psyr_0034
Enzymes [BR:psb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psyr_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 3365509
NCBI-ProteinID: YP_233146
UniProt: Q500R4
Position
complement(37998..39227)
Genome map
AA seq 409 aa AA seqDB search
MTQTNFRSGPDANGLFGSFGGRYVAETLMPLVLDLNREYEAAKADPEFIKEMAYFQRDYV
GRPNPLYFAERLTEFCGGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMRLLGAEIVPVTSGTGTLKDAMNE
ALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQAIIGKETKEQMLEKEGRLPDSLVACVG
GGSNAMGLFHPFLDDASVEIIGVEAGGHGVSTDKHAASLNGGVPGVLHGNRTYLLQDGDG
QITDAHSISAGLDYPGIGPEHAFLHEVKRVEYVSITDDEALDAFHQCCLLEGIIPALETA
HALAEAMKRATNLRDDHLMVVCLSGRGDKDMQTVMNHMAAAEHTQEQLV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccaatttccgcagcggccccgacgccaacggcctgttcggctcattcggc
ggccgctacgtggctgaaaccctgatgccgctggtgttagacctcaaccgcgagtacgaa
gcggccaaggccgacccggaattcatcaaagaaatggcttactttcagcgcgattacgtg
ggccgtcccaacccgctgtacttcgccgaacgcctgaccgaattctgcggcggcgcgaag
atctacttcaagcgcgaagagctcaatcacaccggcgcgcacaagatcaacaactgcatc
ggccaggtactgctggccaagcgcatgggcaaaaaacgcctgatcgcggaaaccggcgcc
ggcatgcacggcgttgccactgctaccgttgctgcacgtttcggtctgccttgcgtgatc
tacatgggcgctaccgacatcgagcgtcagcaggccaacgtgttccgcatgaggctgctg
ggcgctgaaatcgttccggtcacctccggcaccggcaccctgaaagatgcgatgaacgaa
gcgctgcgtgactgggtgaccaacgtcgacgacactttctacctgatcggcaccgtggca
ggcccgcacccttacccggcgatggtccgtgacttccaggccatcatcggcaaggaaacc
aaagagcagatgctggagaaggaaggtcgtctgccggacagcctggttgcctgtgtcggt
ggtggttccaacgccatgggcctgtttcatccgttcctggatgacgccagcgtggaaatc
atcggcgtcgaggcgggcggtcatggtgtcagcaccgacaagcacgcggccagcctgaac
ggcggcgtaccgggcgtgctgcacggcaaccgcacttacctgctgcaggacggcgacggg
cagatcactgatgcacactcgatctctgccggcctggactaccccggcatcggcccggaa
cacgcattcctgcacgaagtgaagcgcgtcgaatacgtcagcatcaccgatgacgaagcg
ctggacgctttccatcagtgctgcctgctcgaaggcatcatcccggcgctggaaaccgct
cacgccctggccgaagccatgaagcgcgcgaccaacctgcgcgatgatcacctgatggtc
gtgtgcctgtccgggcgcggcgacaaagacatgcaaaccgtcatgaaccacatggccgcc
gccgaacacactcaggagcagctggtatga

DBGET integrated database retrieval system