KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0034Help
Entry
Psyr_0034         CDS       T00246                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:psb00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:psb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(37998..39227)
Genome map
AA seq 409 aa AA seqDB search
MTQTNFRSGPDANGLFGSFGGRYVAETLMPLVLDLNREYEAAKADPEFIKEMAYFQRDYV
GRPNPLYFAERLTEFCGGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMRLLGAEIVPVTSGTGTLKDAMNE
ALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQAIIGKETKEQMLEKEGRLPDSLVACVG
GGSNAMGLFHPFLDDASVEIIGVEAGGHGVSTDKHAASLNGGVPGVLHGNRTYLLQDGDG
QITDAHSISAGLDYPGIGPEHAFLHEVKRVEYVSITDDEALDAFHQCCLLEGIIPALETA
HALAEAMKRATNLRDDHLMVVCLSGRGDKDMQTVMNHMAAAEHTQEQLV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccaatttccgcagcggccccgacgccaacggcctgttcggctcattcggc
ggccgctacgtggctgaaaccctgatgccgctggtgttagacctcaaccgcgagtacgaa
gcggccaaggccgacccggaattcatcaaagaaatggcttactttcagcgcgattacgtg
ggccgtcccaacccgctgtacttcgccgaacgcctgaccgaattctgcggcggcgcgaag
atctacttcaagcgcgaagagctcaatcacaccggcgcgcacaagatcaacaactgcatc
ggccaggtactgctggccaagcgcatgggcaaaaaacgcctgatcgcggaaaccggcgcc
ggcatgcacggcgttgccactgctaccgttgctgcacgtttcggtctgccttgcgtgatc
tacatgggcgctaccgacatcgagcgtcagcaggccaacgtgttccgcatgaggctgctg
ggcgctgaaatcgttccggtcacctccggcaccggcaccctgaaagatgcgatgaacgaa
gcgctgcgtgactgggtgaccaacgtcgacgacactttctacctgatcggcaccgtggca
ggcccgcacccttacccggcgatggtccgtgacttccaggccatcatcggcaaggaaacc
aaagagcagatgctggagaaggaaggtcgtctgccggacagcctggttgcctgtgtcggt
ggtggttccaacgccatgggcctgtttcatccgttcctggatgacgccagcgtggaaatc
atcggcgtcgaggcgggcggtcatggtgtcagcaccgacaagcacgcggccagcctgaac
ggcggcgtaccgggcgtgctgcacggcaaccgcacttacctgctgcaggacggcgacggg
cagatcactgatgcacactcgatctctgccggcctggactaccccggcatcggcccggaa
cacgcattcctgcacgaagtgaagcgcgtcgaatacgtcagcatcaccgatgacgaagcg
ctggacgctttccatcagtgctgcctgctcgaaggcatcatcccggcgctggaaaccgct
cacgccctggccgaagccatgaagcgcgcgaccaacctgcgcgatgatcacctgatggtc
gtgtgcctgtccgggcgcggcgacaaagacatgcaaaccgtcatgaaccacatggccgcc
gccgaacacactcaggagcagctggtatga

DBGET integrated database retrieval system