KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0090Help
Entry
Psyr_0090         CDS       T00246                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Psyr_0090
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psyr_0090
   00310 Lysine degradation
    Psyr_0090
Enzymes [BR:psb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Psyr_0090
    2.6.1.48  5-aminovalerate transaminase
     Psyr_0090
Amino acid related enzymes [BR:psb01007]
 Aminotransferase (transaminase)
  Class III
   Psyr_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(98488..99768)
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLMQRRHAAVPRGVGQIHPIFAASAKNATVTDVEGREFIDFAGGIAVLNTGHLH
PKIIAAVQEQLTKLSHTCFQVLAYEPYVELCEKINAKVPGDFDKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPCELHGVS
VDDSIASIERIFKNDAEPKDIAAIIIEPVQGEGGFYVAPKAFMLRLRELCDKHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPVACAAALAVLDIFEEEHLLERCKAVGEQLVTSLKAMQAKYPVIGEVRALGAMIAVEL
FEDGDSHKPNAAAVAQVVAKARDKGLILLSCGTYGNVLRVLVPLTAEDELLKRGLAILDE
CFAEIA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactaacgaatccctgatgcaacgccgccatgcagccgtcccgcgtggtgtt
ggtcagatccacccgatcttcgctgcttcggcgaagaacgcgaccgttaccgacgttgaa
ggtcgtgagttcatcgacttcgccggcggtattgccgtgctgaacaccggtcacctgcac
ccgaagatcatcgccgccgtgcaagaacagctgaccaagctgagccacacctgcttccag
gtactggcctacgagccttacgtcgagctgtgcgaaaaaatcaacgccaaagtgccaggc
gatttcgacaagaaaaccctgctggtgaccaccggttccgaagcagtggaaaacgctgtg
aagatcgcccgtgctgcgacgggtcgtgcgggcgttatcgccttcaccggcgcttaccac
ggccgcaccatgatgaccctgggtctgaccggcaaagtcgtgccttactcggccggcatg
ggcctgatgccaggcggtatcttccgcgcgctgtacccgtgcgaactgcatggcgtgagc
gtggatgattccatcgccagcatcgagcgcattttcaagaatgacgccgagcccaaggac
attgctgcaatcatcatcgaaccggtacagggcgagggtggtttctatgtggcgccgaag
gccttcatgctgcgtctgcgcgagctgtgcgacaagcacggcattctgctgatcgctgac
gaagtgcagaccggcgctggccgtaccggcacgttcttcgcgatggagcagatgggcgtt
gcggctgacctgactactttcgccaagtccatcgcaggcggcttcccgctggcgggcgtg
tgcggcaaggctgaatacatggacgccatcgcacctggcggtctgggcggcacgtatgcc
ggtagcccggtggcctgcgctgcggcactggcggtgctggacatcttcgaagaagagcac
ttgctggagcgctgcaaggcggttggcgagcagttggtgacctcgctcaaggcgatgcag
gccaagtacccggttatcggtgaagtgcgtgcgctcggtgcgatgatcgctgtcgagctg
ttcgaagacggcgactcgcacaagcctaacgccgctgcagtggctcaggtggttgccaag
gcgcgtgacaagggtctgattctgttgtcctgcggtacttacggcaacgtgttgcgcgtg
ctggtgccgttgaccgccgaagacgaattgctcaaacgcggcctggccattcttgacgaa
tgctttgctgaaatcgcgtaa

DBGET integrated database retrieval system