KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0219Help
Entry
Psyr_0219         CDS       T00246                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyr_0219
   00030 Pentose phosphate pathway
    Psyr_0219
   00051 Fructose and mannose metabolism
    Psyr_0219
   00052 Galactose metabolism
    Psyr_0219
   00500 Starch and sucrose metabolism
    Psyr_0219
   00520 Amino sugar and nucleotide sugar metabolism
    Psyr_0219
  Nucleotide metabolism
   00230 Purine metabolism
    Psyr_0219
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psyr_0219
Enzymes [BR:psb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Psyr_0219
    5.4.2.8  phosphomannomutase
     Psyr_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(232009..233406)
Genome map
AA seq 465 aa AA seqDB search
MNSPASVAPNLPETIFRAYDIRGVVGDTLNAETAYWIGRAIGSESLAQNEPNVSVGRDGR
LSGPELVQQLIQGLHDSGCHVSDVGLVPTPALYYAANVLAGKTGVMLTGSHNPKDYNGFK
IVIAGDTLANEQIQALHERIKTNNLTSQKGSITQVDILERYFQQIKNDIVMARKLKVVVD
CGNGAAGVIAPQLIEALGCEVISLFAEVDGNFPNHHPDPGKLENLQDLIAKVKETGADLG
LAFDGDGDRVGVVTNAGNVVYPDRLLMLFALDVLKRNPGADIIFDVKCTRRLTPLISEHG
GRPVMWKTGHSLIKKEMKKSGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILSQESA
NAEDLFETFPNDISTPEINIKVTDVTKFSIIKALETDAQWGDAKLTTIDGVRVDYPKGWG
LVRASNTTPVLVLRFEAETEAELQRIKDVFHAELKKVAPDLDLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcccagcatccgtggcacccaaccttcccgagactattttccgagcctacgac
atccgtggcgtggtcggggacaccctcaacgctgaaacggcttactggatcggccgcgcc
atcggctccgaaagcctggcgcagaacgaacccaacgtcagcgttggccgcgacggtcgc
ctttccggtcctgaactggtacagcaactgattcaaggtctgcacgacagcggctgccac
gtcagcgatgtaggcctggtgccaacgcctgcgctgtattacgcagccaacgtgctggcc
ggcaagaccggcgtcatgctgaccggcagccataacccgaaggactacaacggcttcaag
atcgtcatcgccggcgacaccctcgccaacgagcagatccaggcgctgcacgagcgcatc
aagaccaacaacctgacgtcgcagaaaggcagcatcacccaggtcgacatccttgagcgc
tacttccagcagatcaagaatgacatcgtcatggcgcgcaagctgaaggtcgtggtcgac
tgcggtaacggcgcggcaggcgtgatcgctccgcaactgatcgaagcgctgggctgtgaa
gtgatttccctgttcgcggaagtggatggcaacttccccaaccatcacccggatccgggc
aagctggaaaacctgcaggacttgatcgccaaggtcaaggaaaccggtgccgacctgggc
ctggctttcgacggtgacggcgaccgtgtcggtgtcgtgaccaacgcaggcaacgtggtg
tacccggaccgcctgttgatgctgttcgcgctggacgtgctcaagcgcaatccgggtgcc
gacatcattttcgacgtcaaatgcacacgccgcctgactccgctgatcagcgagcatggc
ggccgtccggtgatgtggaaaaccggtcactcgctgatcaagaaagaaatgaagaaaagc
ggtgcgctgctggcaggcgaaatgagcggccacatcttcttcaaggaacgctggttcggt
ttcgacgacggtatctacagcgcagcacgcctgctggagatcctcagccaggagtcggcc
aacgccgaagacctgttcgagaccttcccgaacgatatttcgacgcctgaaatcaacatc
aaggtgacggatgtcaccaagttcagcatcatcaaggcccttgaaacggatgcgcagtgg
ggcgacgccaaactgaccaccatcgacggtgtccgtgtggactatccgaagggctggggt
ctggttcgcgcttccaataccacgccggtactggtgctgcgtttcgaagccgagaccgag
gccgaattgcagcgtatcaaggacgtgttccacgcagaactgaagaaagttgcgccggac
ctcgacctgccattttga

DBGET integrated database retrieval system