KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0266Help
Entry
Psyr_0266         CDS       T00246                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
psb  Pseudomonas syringae pv. syringae B728a
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(282921..284993)
Genome map
AA seq 690 aa AA seqDB search
MSDDAERWKEKYLKGIEQQDTLEKRWDARLDLLRRGLVRSSLAAEGSDRAVDECMKEMRE
IVRKDDMDAGLAALIPRLEKAVLDSEQRREVRAAQISSALTALVAQLQSLPLPRDVRKPL
KRFAKELEERASQARELPLLLGELSNLQGQALTQIEKPEEGPRQGLLQRLFGSREGHGHE
PHPEAAHPEDAASSAPESHEPDVAPQAANTYAPPDASPVEAEAVDSTAAAAVAADSTPPT
PAPETDAPAAVIPAVATPEEPAPSTTAADIAPAPTEAVAEPAPITVEPIDFADLLAPVPS
VPYQQRPAPIDVPVEEPDAEAEQQPESAEGEEGYALPSSPEPSYSSVAAHIEQTLLGLLD
DLTLSEHFRPQVEDMQLRLKHGLNWYELLPILDDLAVLMLAINNGGQQEFGTYLKQLNER
LESFQSHLQAASEDHAEDQSTARDLNEQLREQVGGLQSSVQDASDLPSLKRVLDNRLEAL
LGTMDHYQLKRDAREREVASRLQGLAARVASMEQEALGFRTHLEEQRQKALIDPLTGLPN
RAAWGERLEREMARWHEEKNSLLVCILDLDHFKRINDGYGHLAGDKVLKIVANVLSKRLR
ADDFMARFGGEEFVMLLPATPPATGLKLLDELRAAVESCPFHFKGERVTITVSIGMTAFR
PSERSDTAIKRADQALYKAKENGRNRIEQG
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgcggagcgttggaaagagaaatacctcaaagggatcgagcaacaggac
acgctcgaaaagcgctgggatgcgcggctcgatttgttgcgacgcggtctggtgcgcagc
agtctggcggcagaaggctctgaccgcgccgtcgatgaatgcatgaaggaaatgcgcgaa
atcgtccgcaaggacgatatggacgcgggcctggcagccctgatcccgcgcctcgaaaaa
gccgtactggactctgaacaacgccgtgaagtcagggccgcgcaaatcagctcggcgctg
accgcactggttgcacagctgcagtcactgccgctgccacgcgacgtacgcaagccgctc
aagcgctttgccaaggagcttgaagagcgcgcctcccaggcccgtgagctgcccctgctg
cttggcgagttgagcaatttgcagggccaggccctgacccagattgaaaaacctgaagaa
ggtccccgtcaggggctgctgcaacgcctgttcggttcgcgcgagggtcacggccacgag
cctcatcctgaggcggctcatcccgaagacgccgcctcctcggcgccggaatcgcatgaa
cccgacgtcgcgccgcaagcagcgaatacttacgccccgccagacgcgtctcctgtcgaa
gccgaggccgttgattccactgccgcagccgccgttgccgcagacagcacgccgccaacg
ccggccccggaaaccgatgcgcctgccgcagtgatacccgccgttgcgacgcctgaagaa
cctgcgccatcgaccaccgctgcggacattgctccagcgccaacagaggccgtcgccgaa
cctgcaccgatcactgtcgaacccatcgatttcgcggatctcctggcgcctgtcccatca
gtgccctaccagcagcgacccgcgccaatcgacgtgccagttgaagaacccgacgcagag
gccgagcagcagcccgagtcggcagaaggcgaagaaggttacgcgctaccctcctcacca
gagcccagctatagctcggtggcggcacacattgaacagaccctgctgggcctgctggac
gacctgaccctgtcagagcactttcgcccccaggtcgaggacatgcagttacgcttgaaa
catgggcttaactggtacgaattgctgccgatcctcgacgatctggcagtgttgatgctg
gcgatcaacaacggcggccaacaggagttcggcacttacctcaagcagctcaatgaacgg
ctcgaatcgtttcagagccacctgcaggccgccagtgaagatcacgccgaggaccagtcc
accgcgcgcgacctgaacgaacagttgcgcgaacaggtgggcggcctgcaaagcagtgtt
caggacgcctccgatctgcccagcctcaagcgggtgctcgacaatcggcttgaggccctg
ctcggcaccatggatcactaccagctcaagcgcgatgcccgcgagcgcgaagtggcctcg
cgcctgcaaggtctggcggcccgcgtcgcgagcatggagcaggaggccctgggtttcagg
actcacctggaggaacagcgtcaaaaggccctgatcgacccgcttaccggactgcccaat
cgtgccgcctggggcgagcgccttgaacgggagatggcccgctggcacgaagaaaaaaac
agcctgctggtgtgcattctggacctggaccatttcaaacgcatcaacgatggctacggg
cacctggctggcgacaaggtattgaagatcgtcgccaatgtcctcagcaaacgcctgcgc
gccgatgacttcatggcacggtttggcggcgaagaatttgtcatgctgctgcctgcgaca
cctcctgccaccgggctgaaactgctcgatgaactgcgcgccgccgtcgagtcatgccct
ttccacttcaagggcgaacgagtcaccatcactgtatccatcggcatgacggcctttcgt
ccgtcagagcggagcgacaccgccatcaaacgtgccgaccaggcgctttacaaggccaag
gagaacggtcgcaaccgcatcgaacagggctga

DBGET integrated database retrieval system