KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0292Help
Entry
Psyr_0292         CDS       T00246                                 

Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00860  Porphyrin and chlorophyll metabolism
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01120  Microbial metabolism in diverse environments
Module
psb_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Psyr_0292
Enzymes [BR:psb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Psyr_0292
Exosome [BR:psb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psyr_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 3365768
NCBI-ProteinID: YP_233403
UniProt: Q4ZZQ7
Position
310413..311423
Genome map
AA seq 336 aa AA seqDB search
MSFTPANRLFPLTRLRRNRRDDFSRRLVRENVVTVDDLILPVFVLDGENRRESIASMPGV
ERLSVDLLLKEAEHWVALGIPALALFPVTPPEKKSLDGAEAWNPDGIAQRATRALRDRFP
ELGVITDVALDPFTTHGQDGILDEEGYVQNDITVDALVKQALSHADAGAQVIAPSDMMDG
RIQAIRESLELAGHVNVRIMAYSAKYASAYYGPFRDAVGSSLNLGKANKASYQMDPANSN
EALHEVAADLAEGADMVMVKPGMPYLDILYRVKDEFKVPTFVYQVSGEYAMHMAAIQNGW
LSEGVILESLTAFKRAGADGILTYFAVRAAQLLKGQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgagctttacccccgctaaccgcctgtttcctctcactcgtctgcgccgtaatcgccgc
gacgacttttcccgtcggctggtgcgtgaaaacgttgtcactgtcgacgatctgattctt
ccggtatttgtactcgatggtgaaaaccgtcgtgaatccatcgcctcgatgcctggcgtc
gagcgcttgagcgtggatctgttgctcaaggaagccgagcactgggtcgcgctgggtatc
cctgcgctggcgctgttcccggtgacaccaccggaaaagaaatccctcgacggcgccgaa
gcctggaacccggacggcatcgcccagcgcgcgacccgcgccctgcgtgaccgtttcccg
gagctgggcgtcatcactgatgtggcgctggacccgttcaccacgcatggtcaggacggc
atcctcgacgaagagggctatgttcagaacgacatcactgtcgacgcgctggtgaagcag
gcgctgtcgcacgcagatgccggtgctcaggtgatcgctccgtcggacatgatggacggt
cgtattcaggccatccgcgagtctctggagctggccgggcatgtcaatgtcaggatcatg
gcctattcggccaagtacgccagtgcctactacggcccgttccgtgatgcggtgggttcc
tccctgaatctgggcaaggccaacaaggcctcctatcagatggacccggccaacagcaac
gaggccctgcacgaagtggcggccgaccttgccgaaggcgccgacatggtcatggtcaag
ccaggcatgccttatctggacattctgtacagggtcaaggatgagttcaaagtgccgacc
tttgtttatcaggtcagcggtgaatacgcgatgcacatggccgcaatccagaacggttgg
ctgagtgaaggggtgattctcgaatccctcactgccttcaaacgcgccggcgccgacggc
atccttacctactttgctgttcgcgccgctcaactgttgaaggggcaatag

DBGET integrated database retrieval system